NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS41892.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41892.1 Public Homo sapiens 13 ATP7B 22 109 92 CCDS HistoryNCBI Gene:540Re-query CCDS DB by CCDS ID:41892.1Re-query CCDS DB by GeneID:540See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41892.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000242839.8 ENSP00000242839.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000242839.8Link to Ensembl Protein Viewer:ENSP00000242839.4Re-query CCDS DB by Nucleotide ID:ENST00000242839Re-query CCDS DB by Protein ID:ENSP00000242839
Original member Current member NCBI NM_000053.3 NP_000044.2 Accepted alive Link to Nucleotide Sequence:NM_000053.3Link to Protein Sequence:NP_000044.2Re-query CCDS DB by Nucleotide ID:NM_000053Re-query CCDS DB by Protein ID:NP_000044Link to BLAST:NP_000044.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000044.2 1465 P35670-1 1465 100% 0 0

Chromosomal Locations for CCDS 41892.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 51934756 51935029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51935593 51935695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51937276 51937393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51937476 51937679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51939051 51939193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51941081 51941224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51942386 51942554 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51944109 51944291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51946284 51946478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51949662 51949796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51950007 51950161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51950272 51950399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51957516 51957607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51958311 51958544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51960148 51960322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51961837 51961913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51964872 51965033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51968444 51968607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51970492 51970749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 51973935 51975168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 52011287 52011337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4398 nt):
ATGCCTGAGCAGGAGAGACAGATCACAGCCAGAGAAGGGGCCAGTCGGAAAATCTTATCTAAGCTTTCTT
TG
CCTACCCGTGCCTGGGAACCAGCAATGAAGAAGAGTTTTGCTTTTGACAATGTTGGCTATGAAGGTGG
T
CTGGATGGCCTGGGCCCTTCTTCTCAGGTGGCCACCAGCACAGTCAGGATCTTGGGCATGACTTGCCAG
TCA
TGTGTGAAGTCCATTGAGGACAGGATTTCCAATTTGAAAGGCATCATCAGCATGAAGGTTTCCCTGG
AA
CAAGGCAGTGCCACTGTGAAATATGTGCCATCGGTTGTGTGCCTGCAACAGGTTTGCCATCAAATTGG
G
GACATGGGCTTCGAGGCCAGCATTGCAGAAGGAAAGGCAGCCTCCTGGCCCTCAAGGTCCTTGCCTGCC
CAG
GAGGCTGTGGTCAAGCTCCGGGTGGAGGGCATGACCTGCCAGTCCTGTGTCAGCTCCATTGAAGGCA
AG
GTCCGGAAACTGCAAGGAGTAGTGAGAGTCAAAGTCTCACTCAGCAACCAAGAGGCCGTCATCACTTA
T
CAGCCTTATCTCATTCAGCCCGAAGACCTCAGGGACCATGTAAATGACATGGGATTTGAAGCTGCCATC
AAG
AGCAAAGTGGCTCCCTTAAGCCTGGGACCAATTGATATTGAGCGGTTACAAAGCACTAACCCAAAGA
GA
CCTTTATCTTCTGCTAACCAGAATTTTAATAATTCTGAGACCTTGGGGCACCAAGGAAGCCATGTGGT
C
ACCCTCCAACTGAGAATAGATGGAATGCATTGTAAGTCTTGCGTCTTGAATATTGAAGAAAATATTGGC
CAG
CTCCTAGGGGTTCAAAGTATTCAAGTGTCCTTGGAGAACAAAACTGCCCAAGTAAAGTATGACCCTT
CT
TGTACCAGCCCAGTGGCTCTGCAGAGGGCTATCGAGGCACTTCCACCTGGGAATTTTAAAGTTTCTCT
T
CCTGATGGAGCCGAAGGGAGTGGGACAGATCACAGGTCTTCCAGTTCTCATTCCCCTGGCTCCCCACCG
AGA
AACCAGGTCCAGGGCACATGCAGTACCACTCTGATTGCCATTGCCGGCATGACCTGTGCATCCTGTG
TC
CATTCCATTGAAGGCATGATCTCCCAACTGGAAGGGGTGCAGCAAATATCGGTGTCTTTGGCCGAAGG
G
ACTGCAACAGTTCTTTATAATCCCTCTGTAATTAGCCCAGAAGAACTCAGAGCTGCTATAGAAGACATG
GGA
TTTGAGGCTTCAGTCGTTTCTGAAAGCTGTTCTACTAACCCTCTTGGAAACCACAGTGCTGGGAATT
CC
ATGGTGCAAACTACAGATGGTACACCTACATCTGTGCAGGAAGTGGCTCCCCACACTGGGAGGCTCCC
T
GCAAACCATGCCCCGGACATCTTGGCAAAGTCCCCACAATCAACCAGAGCAGTGGCACCGCAGAAGTGC
TTC
TTACAGATCAAAGGCATGACCTGTGCATCCTGTGTGTCTAACATAGAAAGGAATCTGCAGAAAGAAG
CT
GGTGTTCTCTCCGTGTTGGTTGCCTTGATGGCAGGAAAGGCAGAGATCAAGTATGACCCAGAGGTCAT
C
CAGCCCCTCGAGATAGCTCAGTTCATCCAGGACCTGGGTTTTGAGGCAGCAGTCATGGAGGACTACGCA
GGC
TCCGATGGCAACATTGAGCTGACAATCACAGGGATGACCTGCGCGTCCTGTGTCCACAACATAGAGT
CC
AAACTCACGAGGACAAATGGCATCACTTATGCCTCCGTTGCCCTTGCCACCAGCAAAGCCCTTGTTAA
G
TTTGACCCGGAAATTATCGGTCCACGGGATATTATCAAAATTATTGAGGAAATTGGCTTTCATGCTTCC
CTG
GCCCAGAGAAACCCCAACGCTCATCACTTGGACCACAAGATGGAAATAAAGCAGTGGAAGAAGTCTT
TC
CTGTGCAGCCTGGTGTTTGGCATCCCTGTCATGGCCTTAATGATCTATATGCTGATACCCAGCAACGA
G
CCCCACCAGTCCATGGTCCTGGACCACAACATCATTCCAGGACTGTCCATTCTAAATCTCATCTTCTTT
ATC
TTGTGTACCTTTGTCCAGCTCCTCGGTGGGTGGTACTTCTACGTTCAGGCCTACAAATCTCTGAGAC
AC
AGGTCAGCCAACATGGACGTGCTCATCGTCCTGGCCACAAGCATTGCTTATGTTTATTCTCTGGTCAT
C
CTGGTGGTTGCTGTGGCTGAGAAGGCGGAGAGGAGCCCTGTGACATTCTTCGACACGCCCCCCATGCTC
TTT
GTGTTCATTGCCCTGGGCCGGTGGCTGGAACACTTGGCAAAGAGCAAAACCTCAGAAGCCCTGGCTA
AA
CTCATGTCTCTCCAAGCCACAGAAGCCACCGTTGTGACCCTTGGTGAGGACAATTTAATCATCAGGGA
G
GAGCAAGTCCCCATGGAGCTGGTGCAGCGGGGCGATATCGTCAAGGTGGTCCCTGGGGGAAAGTTTCCA
GTG
GATGGGAAAGTCCTGGAAGGCAATACCATGGCTGATGAGTCCCTCATCACAGGAGAAGCCATGCCAG
TC
ACTAAGAAACCCGGAAGCACTGTAATTGCGGGGTCTATAAATGCACATGGCTCTGTGCTCATTAAAGC
T
ACCCACGTGGGCAATGACACCACTTTGGCTCAGATTGTGAAACTGGTGGAAGAGGCTCAGATGTCAAAG
GCA
CCCATTCAGCAGCTGGCTGACCGGTTTAGTGGATATTTTGTCCCATTTATCATCATCATGTCAACTT
TG
ACGTTGGTGGTATGGATTGTAATCGGTTTTATCGATTTTGGTGTTGTTCAGAGATACTTTCCTAACCC
C
AACAAGCACATCTCCCAGACAGAGGTGATCATCCGGTTTGCTTTCCAGACGTCCATCACGGTGCTGTGC
ATT
GCCTGCCCCTGCTCCCTGGGGCTGGCCACGCCCACGGCTGTCATGGTGGGCACCGGGGTGGCCGCGC
AG
AACGGCATCCTCATCAAGGGAGGCAAGCCCCTGGAGATGGCGCACAAGATAAAGACTGTGATGTTTGA
C
AAGACTGGCACCATTACCCATGGCGTCCCCAGGGTCATGCGGGTGCTCCTGCTGGGGGATGTGGCCACA
CTG
CCCCTCAGGAAGGTTCTGGCTGTGGTGGGGACTGCGGAGGCCAGCAGTGAACACCCCTTGGGCGTGG
CA
GTCACCAAATACTGTAAAGAGGAACTTGGAACAGAGACCTTGGGATACTGCACGGACTTCCAGGCAGT
G
CCAGGCTGTGGAATTGGGTGCAAAGTCAGCAACGTGGAAGGCATCCTGGCCCACAGTGAGCGCCCTTTG
AGT
GCACCGGCCAGTCACCTGAATGAGGCTGGCAGCCTTCCCGCAGAAAAAGATGCAGTCCCCCAGACCT
TC
TCTGTGCTGATTGGAAACCGTGAGTGGCTGAGGCGCAACGGTTTAACCATTTCTAGCGATGTCAGTGA
C
GCTATGACAGACCACGAGATGAAAGGACAGACAGCCATCCTGGTGGCTATTGACGGTGTGCTCTGTGGG
ATG
ATCGCAATCGCAGACGCTGTCAAGCAGGAGGCTGCCCTGGCTGTGCACACGCTGCAGAGCATGGGTG
TG
GACGTGGTTCTGATCACGGGGGACAACCGGAAGACAGCCAGAGCTATTGCCACCCAGGTTGGCATCAA
C
AAAGTCTTTGCAGAGGTGCTGCCTTCGCACAAGGTGGCCAAGGTCCAGGAGCTCCAGAATAAAGGGAAG
AAA
GTCGCCATGGTGGGGGATGGGGTCAATGACTCCCCGGCCTTGGCCCAGGCAGACATGGGTGTGGCCA
TT
GGCACCGGCACGGATGTGGCCATCGAGGCAGCCGACGTCGTCCTTATCAGAAATGATTTGCTGGATGT
G
GTGGCTAGCATTCACCTTTCCAAGAGGACTGTCCGAAGGATACGCATCAACCTGGTCCTGGCACTGATT
TAT
AACCTGGTTGGGATACCCATTGCAGCAGGTGTCTTCATGCCCATCGGCATTGTGCTGCAGCCCTGGA
TG
GGCTCAGCGGCCATGGCAGCCTCCTCTGTGTCTGTGGTGCTCTCATCCCTGCAGCTCAAGTGCTATAA
G
AAGCCTGACCTGGAGAGGTATGAGGCACAGGCGCATGGCCACATGAAGCCCCTGACGGCATCCCAGGTC
AGT
GTGCACATAGGCATGGATGACAGGTGGCGGGACTCCCCCAGGGCCACACCATGGGACCAGGTCAGCT
AT
GTCAGCCAGGTGTCGCTGTCCTCCCTGACGTCCGACAAGCCATCTCGGCACAGCGCTGCAGCAGACGA
T
GATGGGGACAAGTGGTCTCTGCTCCTGAATGGCAGGGATGAGGAGCAGTACATCTGA


Translation (1465 aa):
MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQ
S
CVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPA
Q
EAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAI
K
SKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIG
Q
LLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPP
R
NQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDM
G
FEASVVS
ESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKC
F
LQIKGMTCASCVSNIERNLQKEA
GVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYA
G
SDGNIELT
ITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHAS
L
AQRNPNAHHLDHKMEIK
QWKKSFLCSLVFGIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFF
I
LCTFVQ
LLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPML
F
VFIALGRWLEHLAK
SKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFP
V
DGKVLEGNTMADESLIT
GEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSK
A
PIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFP
NPNKHISQTEVIIRFAFQTSITVLC
I
ACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHK
IKTVMFDKTGTITHGVPRVMRVLLLGDVAT
L
PLRKVLAVVGTAEASSEHPLGVAVTKYCKE
ELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPL
S
APASHLNEAGSLPAEK
DAVPQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCG
M
IAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQ
VGINKVFAEVLPSHKVAKVQELQNKGK
K
VAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIR
NDLLDVVASIHLSKRTVRRIRINLVLALI
Y
NLVGIPIAA
GVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERYEAQAHGHMKPLTASQV
S
VHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser