NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS41760.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41760.1 Reviewed, update pending Homo sapiens 12 ETNK1 22 109 92 CCDS HistoryNCBI Gene:55500Re-query CCDS DB by CCDS ID:41760.1Re-query CCDS DB by GeneID:55500See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 41760.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000335148.7 ENSP00000334041.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000335148.7Link to Ensembl Protein Viewer:ENSP00000334041.3Re-query CCDS DB by Nucleotide ID:ENST00000335148Re-query CCDS DB by Protein ID:ENSP00000334041
Original member NCBI NM_001039481.1 NP_001034570.1 Updated not alive Link to Nucleotide Sequence:NM_001039481.1Link to Protein Sequence:NP_001034570.1Re-query CCDS DB by Nucleotide ID:NM_001039481Re-query CCDS DB by Protein ID:NP_001034570
Current member NCBI NM_001039481.2 NP_001034570.2 Pending alive Link to Nucleotide Sequence:NM_001039481.2Link to Protein Sequence:NP_001034570.2Re-query CCDS DB by Nucleotide ID:NM_001039481Re-query CCDS DB by Protein ID:NP_001034570Link to BLAST:NP_001034570.2

Chromosomal Locations for CCDS 41760.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 22625164 22625586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22643763 22644022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 22644211 22644304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (777 nt):
ATGCTCTGCGGCCGCCCGCGGTCCAGCTCCGACAACAGGAATTTTCTCCGAGAGCGGGCCGGGCTCAGTT
CA
GCTGCTGTCCAGACCCGGATCGGCAACAGTGCCGCCTCCAGACGTTCTCCTGCCGCTCGCCCGCCCGT
C
CCAGCGCCCCCAGCCCTCCCGCGAGGGCGCCCCGGGACGGAAGGATCCACCAGTCTGTCGGCGCCCGCC
GTT
CTCGTGGTCGCCGTCGCCGTCGTCGTGGTGGTAGTCTCCGCCGTCGCCTGGGCCATGGCCAATTACA
TC
CACGTCCCTCCCGGCTCCCCGGAGGTGCCCAAGCTGAACGTCACCGTTCAGGATCAGGAGGAGCATCG
C
TGCCGGGAGGGGGCCCTGAGCCTCCTGCAACACCTGCGGCCTCACTGGGACCCCCAGGAGGTGACCCTG
CAG
CTCTTCACAGATGGAATCACAAATAAACTTATTGGCTGTTACGTGGGAAACACCATGGAGGATGTAG
TC
CTGGTGAGAATTTATGGCAATAAGACTGAGTTATTAGTCGATCGAGATGAGGAAGTAAAGAGTTTTCG
A
GTGTTGCAGGCTCATGGGTGTGCACCACAACTCTACTGTACCTTCAATAATGGACTATGCTATGAATTT
ATA
CAAGGAGAAGCACTGGATCCAAAGCATGTCTGCAACCCAGCCATTTTCAGTTTATCATCGTTGACTC
TT
TGCAAAGGAAAAACTACAAGATGTTTTGGATTAACCGGCTGCAGAGGGTCAAGGCTTCTGCTTAGTTT
T
TTCTAG


Translation (258 aa):
MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA
V
LVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL
Q
LFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF
I
QGEALDPKHVCNPAIF
SLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser