NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS41714.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41714.1 Public Homo sapiens 11 ALG9 22 109 92 CCDS HistoryNCBI Gene:79796Re-query CCDS DB by CCDS ID:41714.1Re-query CCDS DB by GeneID:79796See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41714.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000531154.5 ENSP00000435517.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000531154.5Link to Ensembl Protein Viewer:ENSP00000435517.1Re-query CCDS DB by Nucleotide ID:ENST00000531154Re-query CCDS DB by Protein ID:ENSP00000435517
Original member Current member NCBI NM_001077691.1 NP_001071159.1 Accepted alive Link to Nucleotide Sequence:NM_001077691.1Link to Protein Sequence:NP_001071159.1Re-query CCDS DB by Nucleotide ID:NM_001077691Re-query CCDS DB by Protein ID:NP_001071159Link to BLAST:NP_001071159.1
Original member Current member NCBI NM_001352413.1 NP_001339342.1 Accepted alive Link to Nucleotide Sequence:NM_001352413.1Link to Protein Sequence:NP_001339342.1Re-query CCDS DB by Nucleotide ID:NM_001352413Re-query CCDS DB by Protein ID:NP_001339342Link to BLAST:NP_001339342.1
Original member Current member NCBI NM_001352414.1 NP_001339343.1 Accepted alive Link to Nucleotide Sequence:NM_001352414.1Link to Protein Sequence:NP_001339343.1Re-query CCDS DB by Nucleotide ID:NM_001352414Re-query CCDS DB by Protein ID:NP_001339343Link to BLAST:NP_001339343.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001071159.1 447 Q9H6U8-4 447 100% 0 0
NP_001339342.1 447 Q9H6U8-4 447 100% 0 0
NP_001339343.1 447 Q9H6U8-4 447 100% 0 0

Chromosomal Locations for CCDS 41714.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 111786397 111786520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111809643 111809773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111836165 111836294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111837468 111837615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111838249 111838399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111840655 111840809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111844601 111844723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111853380 111853485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111853649 111853736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111857602 111857737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 111860547 111860598 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1344 nt):
ATGATGCTAGCCTTCTTGGTTCTCAGCACTGGCATGTTTTGCTCATCATCAGCATTCCTTCCTAGTAGCT
TC
TGTATGTACACTACGTTGATAGCCATGACTGGATGGTATATGGACAAGACTTCCATTGCTGTGCTGGG
A
GTAGCAGCTGGGGCTATCTTAGGCTGGCCATTCAGTGCAGCTCTTGGTTTACCCATTGCCTTTGATTTG
CTG
GTCATGAAACACAGGTGGAAGAGTTTCTTTCATTGGTCGCTGATGGCCCTCATACTATTTCTGGTGC
CT
GTGGTGGTCATTGACAGCTACTATTATGGGAAGTTGGTGATTGCACCACTCAACATTGTTTTGTATAA
T
GTCTTTACTCCTCATGGACCTGATCTTTATGGTACAGAACCCTGGTATTTCTATTTAATTAATGGATTT
CTG
AATTTCAATGTAGCCTTTGCTTTGGCTCTCCTAGTCCTACCACTGACTTCTCTTATGGAATACCTGC
TG
CAGAGATTTCATGTTCAGAATTTAGGCCACCCGTATTGGCTTACCTTGGCTCCAATGTATATTTGGTT
T
ATAATTTTCTTCATCCAGCCTCACAAAGAGGAGAGATTTCTTTTCCCTGTGTATCCACTTATATGTCTC
TGT
GGCGCTGTGGCTCTCTCTGCACTTCAGCACAGTTTTCTGTACTTCCAGAAATGTTACCACTTTGTGT
TT
CAACGATATCGCCTGGAGCACTATACTGTGACATCGAATTGGCTGGCATTAGGAACTGTCTTCCTGTT
T
GGGCTCTTGTCATTTTCTCGCTCTGTGGCACTGTTCAGAGGATATCACGGGCCCCTTGATTTGTATCCA
GAA
TTTTACCGAATTGCTACAGACCCAACCATCCACACTGTCCCAGAAGGCAGACCTGTGAATGTCTGTG
TG
GGAAAAGAGTGGTATCGATTTCCCAGCAGCTTCCTTCTTCCTGACAATTGGCAGCTTCAGTTCATTCC
A
TCAGAGTTCAGAGGTCAGTTACCAAAACCTTTTGCAGAAGGACCTCTGGCCACCCGGATTGTTCCTACT
GAC
ATGAATGACCAGAATCTAGAAGAGCCATCCAGATATATTGATATCAGTAAATGCCATTATTTAGTGG
AT
TTGGACACCATGAGAGAAACACCCCGGGAGCCAAAATATTCATCCAATAAAGAAGAATGGATCAGCTT
G
GCCTATAGACCATTCCTTGATGCTTCTAGATCTTCAAAGCTGCTGCGGGCATTCTATGTCCCCTTCCTG
TCA
GATCAGTATACAGTGTACGTAAACTACACCATCCTCAAACCCCGGAAAGCAAAGCAAATCAGGAAGA
AA
AGTGGAGGTTAG


Translation (447 aa):
MMLAFLVLSTGMFCSSSAFLPSSFCMYTTLIAMTGWYMDKTSIAVLGVAAGAILGWPFSAALGLPIAFDL
L
VMKHRWKSFFHWSLMALILFL
VPVVVIDSYYYGKLVIAPLNIVLYNVFTPHGPDLYGTEPWYFYLINGF
L
NFNVAFALALLVLPLTSLMEYLLQRFH
VQNLGHPYWLTLAPMYIWFIIFFIQPHKEERFLFPVYPLICL
C
GAVALSALQ
HSFLYFQKCYHFVFQRYRLEHYTVTSNWLALGTVFLFGLLSFSRSVALFRGYHGPLDLYP
E
FYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPD
NWQLQFIPSEFRGQLPKPFAEGPLATRIVPT
D
MNDQNLEEPSRY
IDISKCHYLVDLDTMRETPREPKYSSNKEEWISLAYRPFLDASRSSKLLRAFYVPFL
S
DQYTVYVNYTILKPRKAKQIRKKSGG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser