NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS41679.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41679.1 Public Homo sapiens 11 GSTP1 22 109 92 CCDS HistoryNCBI Gene:2950Re-query CCDS DB by CCDS ID:41679.1Re-query CCDS DB by GeneID:2950See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41679.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000398606.8 ENSP00000381607.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000398606.8Link to Ensembl Protein Viewer:ENSP00000381607.3Re-query CCDS DB by Nucleotide ID:ENST00000398606Re-query CCDS DB by Protein ID:ENSP00000381607
Original member Current member EBI ENST00000642444.1 ENSP00000493538.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000642444.1Link to Ensembl Protein Viewer:ENSP00000493538.1Re-query CCDS DB by Nucleotide ID:ENST00000642444Re-query CCDS DB by Protein ID:ENSP00000493538
Original member NCBI NM_000852.3 NP_000843.1 Updated not alive Link to Nucleotide Sequence:NM_000852.3Link to Protein Sequence:NP_000843.1Re-query CCDS DB by Nucleotide ID:NM_000852Re-query CCDS DB by Protein ID:NP_000843
Current member NCBI NM_000852.4 NP_000843.1 Accepted alive Link to Nucleotide Sequence:NM_000852.4Link to Protein Sequence:NP_000843.1Re-query CCDS DB by Nucleotide ID:NM_000852Re-query CCDS DB by Protein ID:NP_000843Link to BLAST:NP_000843.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000843.1 210 P09211 210 100% 0 0

Chromosomal Locations for CCDS 41679.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 67583844 67583844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 67584134 67584169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 67584464 67584570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 67584685 67584772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 67585138 67585241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 67586104 67586211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 67586389 67586577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (633 nt):
ATGCCGCCCTACACCGTGGTCTATTTCCCAGTTCGAGGCCGCTGCGCGGCCCTGCGCATGCTGCTGGCAG
AT
CAGGGCCAGAGCTGGAAGGAGGAGGTGGTGACCGTGGAGACGTGGCAGGAGGGCTCACTCAAAGCCTC
C
TGCCTATACGGGCAGCTCCCCAAGTTCCAGGACGGAGACCTCACCCTGTACCAGTCCAATACCATCCTG
CGT
CACCTGGGCCGCACCCTTGGGCTCTATGGGAAGGACCAGCAGGAGGCAGCCCTGGTGGACATGGTGA
AT
GACGGCGTGGAGGACCTCCGCTGCAAATACATCTCCCTCATCTACACCAACTATGAGGCGGGCAAGGA
T
GACTATGTGAAGGCACTGCCCGGGCAACTGAAGCCTTTTGAGACCCTGCTGTCCCAGAACCAGGGAGGC
AAG
ACCTTCATTGTGGGAGACCAGATCTCCTTCGCTGACTACAACCTGCTGGACTTGCTGCTGATCCATG
AG
GTCCTAGCCCCTGGCTGCCTGGATGCGTTCCCCCTGCTCTCAGCATATGTGGGGCGCCTCAGTGCCCG
G
CCCAAGCTCAAGGCCTTCCTGGCCTCCCCTGAGTACGTGAACCTCCCCATCAATGGCAACGGGAAACAG
TGA


Translation (210 aa):
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL
R
HLGRTL
GLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG
K
TFIVGDQ
ISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser