NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS41583.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41583.1 Public Homo sapiens 11 IFITM2 24 110 108 CCDS HistoryNCBI Gene:10581Re-query CCDS DB by CCDS ID:41583.1Re-query CCDS DB by GeneID:10581See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41583.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000616316.3 ENSP00000484689.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000616316.3Link to Ensembl Protein Viewer:ENSP00000484689.1Re-query CCDS DB by Nucleotide ID:ENST00000616316Re-query CCDS DB by Protein ID:ENSP00000484689
Original member Current member EBI ENST00000680197.1 ENSP00000505840.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000680197.1Link to Ensembl Protein Viewer:ENSP00000505840.1Re-query CCDS DB by Nucleotide ID:ENST00000680197Re-query CCDS DB by Protein ID:ENSP00000505840
Original member Current member NCBI NM_006435.3 NP_006426.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_006435.3Link to Protein Sequence:NP_006426.2Re-query CCDS DB by Nucleotide ID:NM_006435Re-query CCDS DB by Protein ID:NP_006426Link to BLAST:NP_006426.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006426.2 132 Q01629 132 100% 0 0

Chromosomal Locations for CCDS 41583.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 308193 308438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 309013 309165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (399 nt):
ATGAACCACATTGTGCAAACCTTCTCTCCTGTCAACAGCGGCCAGCCTCCCAACTACGAGATGCTCAAGG
AG
GAGCAGGAAGTGGCTATGCTGGGGGTGCCCCACAACCCTGCTCCCCCGATGTCCACCGTGATCCACAT
C
CGCAGCGAGACCTCCGTGCCTGACCATGTGGTCTGGTCCCTGTTCAACACCCTCTTCATGAACACCTGC
TGC
CTGGGCTTCATAGCATTCGCGTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGCGACGTGACCG
GG
GCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTTTGGGCATCTTCATGAC
C
ATTCTGCTCATCATCATCCCAGTGTTGGTCGTCCAGGCCCAGCGATAG


Translation (132 aa):
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTC
C
LGFIAFAYSVK
SRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser