NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS41472.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41472.1 Public Homo sapiens 1 DNAH14 22 109 92 CCDS HistoryNCBI Gene:127602Re-query CCDS DB by CCDS ID:41472.1Re-query CCDS DB by GeneID:127602See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41472.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000366848.5 ENSP00000355813.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000366848.5Link to Ensembl Protein Viewer:ENSP00000355813.1Re-query CCDS DB by Nucleotide ID:ENST00000366848Re-query CCDS DB by Protein ID:ENSP00000355813
Original member Current member EBI ENST00000366850.7 ENSP00000355815.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000366850.7Link to Ensembl Protein Viewer:ENSP00000355815.3Re-query CCDS DB by Nucleotide ID:ENST00000366850Re-query CCDS DB by Protein ID:ENSP00000355815
Original member Current member NCBI NM_144989.3 NP_659426.2 Accepted alive Link to Nucleotide Sequence:NM_144989.3Link to Protein Sequence:NP_659426.2Re-query CCDS DB by Nucleotide ID:NM_144989Re-query CCDS DB by Protein ID:NP_659426Link to BLAST:NP_659426.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_659426.2 228 Q0VDD8-3 228 100% 0 0

Chromosomal Locations for CCDS 41472.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 224952703 224952779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 224954959 224955098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 224960153 224960302 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 224964479 224964609 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 224967431 224967583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 224967680 224967715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (687 nt):
ATGGAGACGTTTATACCCATTGATTTGACAACTGAAAATCAAGAGATGGACAAGGAGGAAACCAAGACAA
AA
CCAAGACTTTTAAGATATGAAGAGAAAAAATATGAAGATGTGAAACCATTAGAGACTCAACCAGCTGA
A
ATAGCAGAAAAGGAAACATTGGAATATAAAACAGTTAGAACATTCTCTGAATCTTTGAAGTCAGAGAAA
ACA
GAAGATTACCTTAGAGAAAGTATAATTCAACAACATATGGTTTCTCCAGAGCCAGCTTCCCTTAAGG
AG
AAAGGGAAGTCAAGGAGAAAAAAGGATCAAACTCATGCTTGTCCAAATGTTAGGAAAGCCAGGCCTGT
G
TCCTATGATAGAACAGAACCAAAAGATGATGATGTGATAAGAAATATTATTAGGCTACGAGAAAAGCTT
GGT
TGGCAAACTATATTACCGCAGCACAGTTTGAAATACGGAAGCTCCAAAATTGCAATTCAGAAGATTA
CT
TTAAAGAAACCTTTGGAAGATGATGGAGAATTTGTTTATTGCCTTCCTCGGAAAAGTCCTAAATCCCT
T
TACAATCCATATGATCTTCAGGTAGTATCGGCTCATACTGCTAAACATTGCAAAGAATTTTGGGTTATT
ACT
GCTTCATTTATCTCAAAGAGATACTTGGTCATTTGTGGAGCAGTTTATATATAA


Translation (228 aa):
METFIPIDLTTENQEMDKEETKTKPRLLRYEEKKYEDVKPLETQPAEIAEKETLEYKTVRTFSESLKSEK
T
E
DYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRTEPKDDDVIRNIIRLREKL
G
WQTILPQHSLKYGSSKIAIQKITLK
KPLEDDGEFVYCLPRKSPKSLYNPYDLQVVSAHTAKHCKEFWVI
T
ASFISK
RYLVICGAVYI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser