NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4134.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4134.2 Public Homo sapiens 5 CEP120 22 109 92 CCDS HistoryNCBI Gene:153241Re-query CCDS DB by CCDS ID:4134.2Re-query CCDS DB by GeneID:153241See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 4134.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000306467.9 ENSP00000303058.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000306467.9Link to Ensembl Protein Viewer:ENSP00000303058.5Re-query CCDS DB by Nucleotide ID:ENST00000306467Re-query CCDS DB by Protein ID:ENSP00000303058
Original member Current member EBI,WTSI ENST00000328236.9 ENSP00000327504.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000328236.9Link to Ensembl Protein Viewer:ENSP00000327504.5Re-query CCDS DB by Nucleotide ID:ENST00000328236Re-query CCDS DB by Protein ID:ENSP00000327504
Original member Current member NCBI NM_153223.3 NP_694955.2 Accepted alive Link to Nucleotide Sequence:NM_153223.3Link to Protein Sequence:NP_694955.2Re-query CCDS DB by Nucleotide ID:NM_153223Re-query CCDS DB by Protein ID:NP_694955Link to BLAST:NP_694955.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_694955.2 986 Q8N960-1 986 100% 0 0

Chromosomal Locations for CCDS 4134.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 123346519 123346753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123349944 123350089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123364496 123364594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123372650 123372772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123377374 123377535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123378336 123378428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123382111 123382200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123382737 123382889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123382986 123383082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123384951 123385133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123386518 123386667 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123388432 123388606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123389924 123390140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123391110 123391337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123393300 123393497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123399136 123399284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123412399 123412540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123416010 123416124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123418359 123418515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 123422950 123422998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2961 nt):
ATGGTCTCCAAATCCGACCAATTGCTCATCGTCGTGTCCATCCTAGAAGGTCGGCATTTCCCCAAACGTC
CA
AAGCATATGCTTGTAGTGGAAGCAAAGTTTGATGGAGAACAGTTGGCTACTGATCCTGTGGACCACAC
T
GACCAGCCAGAATTTGCTACTGAGTTAGCTTGGGAAATTGACAGGAAAGCGCTTCATCAGCACAGGCTA
CAG
CGTACTCCTATCAAACTCCAATGTTTTGCCTTGGATCCTGTAACTTCAGCCAAGGAAACCATAGGTT
AC
ATCGTTCTGGATTTAAGAACCGCTCAAGAAACAAAGCAGGCACCAAAATGGTACCAGTTGCTGAGTAA
T
AAATACACCAAATTCAAGTCTGAGATACAGATAAGTATTGCTTTGGAAACCGATACAAAGCCACCAGTG
GAT
AGCTTTAAAGCAAAGGGGGCTCCCCCTCGAGATGGAAAAGTACCTGCCATCCTGGCTGGACTTGACC
CC
AGGGACATTGTGGCTGTGCTGAATGAAGAGGGAGGCTACCATCAGATTGGACCAGCAGAATACTGTAC
T
GACTCCTTTATTATGTCAGTGACCATAGCATTTGCTACCCAGTTGGAACAGTTAATTCCATGTACCATG
AAA
CTTCCAGAAAGACAGCCTGAGTTTTTCTTTTACTACTCTTTACTGGGAAATGATGTTACAAATGAAC
CC
TTCAATGATTTAATCAACCCAAACTTTGAGCCAGAGAGAGCATCAGTTCGCATCCGTAGCAGTGTAGA
A
ATTCTTCGTGTTTACCTGGCTCTTCAGTCTAAACTGCAGATTCACCTCTGCTGTGGAGACCAGTCACTT
GGA
AGTACAGAAATACCTTTAACTGGATTACTTAAAAAGGGCAGTACAGAAATCAACCAGCACCCAGTCA
CA
GTCGAAGGTGCTTTTACCCTTGACCCTCCAAACAGAGCCAAACAGAAGCTTGCACCTATTCCTGTGGA
G
CTAGCCCCAACTGTGGGAGTGTCTGTGGCTCTGCAGAGAGAAGGCATAGACTCCCAGTCTTTAATTGAA
TTA
AAGACCCAGAATGAACATGAGCCAGAGCATTCAAAGAAGAAAGTTTTAACCCCCATAAAGGAGAAGA
CA
CTTACTGGGCCAAAATCACCAACAGTGTCCCCTGTTCCATCTCACAACCAGTCACCTCCAACAAAAGA
T
GATGCAACAGAAAGTGAAGTGGAAAGTTTACAGTATGATAAGGACACCAAACCAAATCCAAAAGCCAGT
TCT
TCTGTACCTGCTTCACTGGCCCAGCTAGTGACTACATCCAATGCTTCAGAAGTAGCTTCAGGACAGA
AG
ATTGCTGTACCAGCAACATCACATCATTTTTGCTTTTCAATAGACTTAAGGAGTATACATGCCTTGGA
G
ATTGGTTTTCCAATCAACTGTATATTAAGGTACTCATATCCATTCTTTGGAAGTGCAGCTCCTATTATG
ACT
AATCCTCCTGTAGAAGTTCGGAAAAACATGGAAGTTTTTCTTCCCCAGTCTTACTGTGCATTTGATT
TT
GCAACTATGCCTCATCAGCTGCAAGACACCTTCTTAAGGATTCCATTACTGGTTGAACTATGGCACAA
G
GATAAAATGAGTAAAGATTTACTTCTGGGAATTGCGAGAATCCAGCTTTCTAACATCTTGTCTTCAGAA
AAA
ACTCGTTTTTTAGGTTCTAATGGTGAACAGTGTTGGCGTCAAACTTACAGTGAAAGTGTGCCTGTTA
TA
GCAGCACAAGGATCAAATAACAGGATAGCAGATCTTTCTTACACAGTGACTCTAGAAGATTATGGACT
A
GTAAAAATGCGTGAGATTTTTATCTCTGATTCATCTCAGGGTGTATCTGCCGTACAGCAAAAGCCGTCT
TCT
CTTCCTCCAGCACCTTGTCCTTCAGAGATCCAGACAGAGCCTCGTGAAACGTTAGAATACAAAGCAG
CA
CTTGAGCTAGAAATGTGGAAGGAGATGCAAGAAGATATATTTGAAAATCAGCTGAAGCAGAAAGAACT
G
GCTCATATGCAGGCTCTTGCAGAGGAATGGAAGAAAAGGGACCGAGAAAGAGAATCACTAGTAAAGAAA
AAG
GTGGCTGAATATACTATTCTAGAAGGAAAACTTCAAAAAACTCTAATTGACTTGGAGAAGCGAGAGC
AG
CAGCTTGCTAGTGTGGAATCAGAGCTTCAAAGAGAAAAAAAGGAACTGCAATCAGAACGTCAGCGGAA
C
CTGCAAGAACTGCAGGACTCTATCCGTAGGGCCAAAGAGGACTGTATTCACCAAGTAGAACTAGAAAGG
TTA
AAAATCAAACAGCTCGAAGAGGATAAACACCGCCTTCAGCAACAGCTTAATGATGCTGAAAATAAGT
AT
AAGATTTTGGAAAAAGAGTTCCAACAGTTCAAGGACCAGCAAAACAACAAACCAGAAATCCGTCTACA
G
TCTGAAATAAATCTTCTCACCTTGGAAAAGGTTGAACTTGAAAGAAAGTTGGAATCTGCAACTAAGTCT
AAA
CTGCATTACAAGCAGCAGTGGGGACGAGCTTTGAAAGAACTTGCCAGACTTAAACAGAGGGAGCAAG
AA
AGTCAAATGGCTCGTCTTAAAAAACAGCAGGAAGAATTGGAACAGATGAGACTACGTTACCTTGCCGC
T
GAGGAAAAAGATACAGTAAAAACCGAGCGACAAGAATTGTTGGATATAAGAAATGAATTGAACAGGTTA
AGG
CAACAAGAGCAAAAACAATACCAGGATTCCACAGAGATTGCAAGTGGAAAAAAGGATGGCCCCCATG
GC
AGTGTATTGGAAGAAGGTTTGGATGATTATTTGACTCGCCTGATAGAAGAAAGGGATACTTTGATGAG
A
ACGGGTGTGTATAATCACGAGGATCGAATAATAAGTGAACTCGACCGACAGATCAGAGAGATTTTGGCA
AAA
AGCAATGCCAGTAATTAA


Translation (986 aa):
MVSKSDQLLIVVSILEGRHFPKRPKHMLVVEAKFDGEQLATDPVDHTDQPEFATELAWEIDRKALHQHRL
Q
RTPIKLQCFALDPVTSAKETIGYIVLDLRTAQETKQ
APKWYQLLSNKYTKFKSEIQISIALETDTKPPV
D
SFKAKGAPPRDGK
VPAILAGLDPRDIVAVLNEEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIPCTM
K
LPERQPEFFFYYSLLGNDVTNEPFNDLINPNFEPERASVRIRSSVEILRVYLALQSKLQ
IHLCCGDQSL
G
STEIPLTGLLKKGSTEINQHPVTVEGAFTLDPPNRAKQKLAPIPVELAPTVGVSVALQREGIDSQ
SLIE
L
KTQNEHEPEHSKKKVLTPIKEKTLTGPKSPTVSPVPSHNQSPPTKDDATESEVESLQYDKDTKPNPK
AS
S
SVPASLAQLVTTSNASEVASGQKIAVPATSHHFCFSIDLRSIHALEIGFPINCIL
RYSYPFFGSAAPIM
T
NPPVEVRKNMEVFLPQSYCAFDFATMPHQLQDTFL
RIPLLVELWHKDKMSKDLLLGIARIQLSNILSSE
K
TRFLGSNGEQCWRQTYSESVPVIAAQ
GSNNRIADLSYTVTLEDYGLVKMREIFISDSSQGVSAVQQKPS
S
LPPAPCPSEIQTEPRETLEYKAALELEMWKEMQEDIFENQ
LKQKELAHMQALAEEWKKRDRERESLVKK
K
VAEYTILEGKLQKTLIDLEKREQQLASVESELQREKKELQSERQRNLQELQDSIRRAKEDCIHQVELER
L
KIKQLEEDKHRLQQQ
LNDAENKYKILEKEFQQFKDQQNNKPEIRLQSEINLLTLEKVELERKLESATKS
K
LHYKQQWGRALKELARLKQ
REQESQMARLKKQQEELEQMRLRYLAAEEKDTVKTERQELLDIRNELNRL
R
QQEQKQYQDSTEIASGKKDGPHGSVLEEGLDDYLTRLIEERDTLMRTGVYNHEDRIISELDRQIREILA
K
SNASN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser