NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS41306.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41306.1 Public Homo sapiens 1 INPP5B 22 109 92 CCDS HistoryNCBI Gene:3633Re-query CCDS DB by CCDS ID:41306.1Re-query CCDS DB by GeneID:3633See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41306.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000373024.7 ENSP00000362115.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373024.7Link to Ensembl Protein Viewer:ENSP00000362115.3Re-query CCDS DB by Nucleotide ID:ENST00000373024Re-query CCDS DB by Protein ID:ENSP00000362115
Original member NCBI NM_005540.2 NP_005531.2 Updated not alive Link to Nucleotide Sequence:NM_005540.2Link to Protein Sequence:NP_005531.2Re-query CCDS DB by Nucleotide ID:NM_005540Re-query CCDS DB by Protein ID:NP_005531
Current member NCBI NM_005540.3 NP_005531.2 Accepted alive Link to Nucleotide Sequence:NM_005540.3Link to Protein Sequence:NP_005531.2Re-query CCDS DB by Nucleotide ID:NM_005540Re-query CCDS DB by Protein ID:NP_005531Link to BLAST:NP_005531.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005531.2 913 P32019-2 913 100% 0 0

Chromosomal Locations for CCDS 41306.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 37862315 37862430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37864312 37864423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37865761 37865888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37866459 37866543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37868501 37868614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37872930 37873165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37873993 37874155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37875606 37875716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37878188 37878323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37880085 37880194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37882807 37882918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37885638 37885825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37886888 37887004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37887351 37887465 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37888243 37888344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37889557 37889724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37891358 37891454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37931913 37932053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37940688 37940798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37943640 37943669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37943796 37943893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37945756 37945850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37946252 37946308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2742 nt):
ATGGACCAGTCTGTGGCAATCCAGGAGACGCTGGCTGAGGGGGAATACTGCGTCATCGCGGTGCAAGGTG
TG
CTGTGTGAGGGGGACAGCCGGCAGAGCCGCCTCCTGGGACTCGTGCGCTACCGCCTGGAGCACGGCGG
C
CAGGAACACGCTCTCTTCCTCTATACGCACCGGAGGATGGCCATTACCGGGGACGATGTCTCTCTGGAC
CAG
ATAGTGCCAGTCTCGCGGGATTTTACGCTGGAAGAAGTGTCCCCAGATGGTGAACTCTACATCCTTG
GC
TCAGATGTGACCGTCCAGCTGGACACAGCAGAGCTTAGCCTCGTATTCCAACTGCCCTTTGGTTCACA
A
ACCAGGATGTTCCTCCACGAAGTTGCCAGGGCCTGTCCAGGCTTCGATTCTGCGACCCGGGATCCTGAA
TTC
CTGTGGCTGTCTCGGTATAGGTGCGCAGAGCTGGAGCTGGAGATGCCAACGCCGCGCGGTTGTAACT
CG
GCCCTAGTTACCTGGCCAGGGTACGCGACAATTGGCGGAGGTGGTTCTAACTTTGATGGTTTGAGACC
A
AATGGGAAGGGAGTGCCTATGGACCAAAGCTCCAGGGGTCAAGATAAACCAGAAAGCTTGCAACCAAGA
CAG
AATAAATCCAAGTCCGAAATTACTGACATGGTTCGCTCCTCCACTATCACAGTGTCGGACAAGGCTC
AT
ATTTTATCCATGCAGAAGTTTGGACTGCGAGATACAATTGTGAAATCACATCTACTACAGAAAGAAGA
G
GATTACACCTATATCCAGAACTTCAGGTTTTTTGCGGGAACATACAATGTAAATGGGCAGTCCCCCAAA
GAA
TGCCTCCGGCTGTGGCTGAGCAATGGTATCCAGGCCCCAGATGTCTATTGTGTAGGGTTCCAGGAGC
TT
GATCTGAGTAAGGAAGCTTTTTTCTTTCACGATACCCCAAAGGAGGAAGAGTGGTTCAAAGCTGTGTC
A
GAGGGTCTTCATCCAGATGCCAAATATGCAAAGGTGAAGCTTATCCGACTGGTTGGGATTATGCTGCTG
TTA
TATGTCAAACAGGAGCATGCAGCTTATATCTCAGAAGTGGAAGCCGAGACTGTGGGGACAGGAATCA
TG
GGGAGGATGGGCAACAAGGGAGGCGTGGCGATCAGGTTCCAGTTCCACAACACCAGCATCTGCGTTGT
G
AATTCTCACTTGGCAGCCCACATTGAAGAGTATGAGAGGAGGAACCAGGACTATAAGGACATTTGTTCT
CGA
ATGCAGTTTTGTCAGCCTGACCCAAGCCTTCCCCCTCTCACCATCAGCAACCATGATGTGATCTTGT
GG
CTGGGGGACCTCAACTACAGGATAGAAGAGCTGGATGTGGAAAAAGTGAAAAAGCTCATCGAAGAGAA
G
GACTTTCAAATGCTGTATGCATATGATCAGCTGAAAATTCAGGTGGCCGCAAAGACTGTCTTTGAAGGC
TTC
ACAGAGGGTGAGCTCACATTCCAGCCTACTTACAAGTATGATACGGGCTCTGACGACTGGGATACCA
G
T
GAGAAGTGCCGTGCTCCTGCCTGGTGTGATCGGATTCTCTGGAAAGGGAAGAACATCACTCAGCTGAG
T
TACCAGAGCCACATGGCCCTGAAGACCAGTGACCACAAGCCTGTCAGCTCAGTGTTTGACATCGGGGTG
AGG
GTCGTAAATGACGAGCTTTACCGGAAGACACTGGAGGAAATTGTTCGCTCCCTGGATAAGATGGAAA
AT
GCCAACATTCCTTCTGTGTCCCTGTCCAAGCGAGAGTTCTGTTTTCAGAATGTGAAGTACATGCAATT
G
AAAGTAGAATCCTTTACAATTCATAATGGACAAGTACCCTGTCATTTTGAATTCATCAACAAGCCTGAT
GAA
GAGTCTTACTGTAAGCAGTGGCTGAATGCCAACCCCAGCAGAGGCTTCCTCCTGCCAGATTCTGATG
TT
GAGATTGACTTGGAGCTCTTCGTAAATAAGATGACAGCTACAAAGCTCAACTCGGGTGAAGACAAAAT
T
GAGGACATTCTGGTTCTGCACTTGGACAGGGGAAAGGATTACTTTTTGTCTGTGTCTGGGAACTACCTG
CCC
AGCTGTTTTGGGTCTCCCATTCATACACTGTGTTACATGAGAGAGCCAATCTTGGACCTACCACTTG
AA
ACCATTAGTGAGCTGACTCTGATGCCAGTATGGACTGGAGATGATGGGAGCCAGTTGGATAGCCCCAT
G
GAAATCCCCAAAGAGCTCTGGATGATGGTTGATTACCTGTACCGAAATGCTGTCCAGCAGGAAGATCTG
TTT
CAGCAACCAGGCCTGAGGTCAGAATTTGAACATATCAGGGACTGCTTGGATACTGGAATGATTGATA
AC
CTCTCTGCCAGCAATCATTCTGTAGCCGAAGCCCTGCTGCTTTTCCTGGAGAGCCTTCCAGAGCCTGT
C
ATCTGTTACAGCACCTACCATAACTGCTTGGAGTGTTCTGGCAACTACACAGCAAGCAAACAGGTCATT
TCT
ACTCTCCCCATATTCCACAAAAATGTCTTCCACTACTTGATGGCGTTTTTGCGAGAACTGCTGAAAA
AT
TCAGCAAAAAATCATTTGGATGAGAATATTCTAGCTAGCATATTTGGCAGCTTATTGCTTCGAAACCC
A
GCTGGTCACCAAAAGCTTGATATGACAGAGAAGAAGAAGGCTCAAGAATTTATTCACCAGTTCCTCTGC
AAC
CCACTCTGA


Translation (913 aa):
MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLD
Q
IVPVSRDFTLEE
VSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPE
F
LWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGG
GGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPR
Q
NKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNF
RFFAGTYNVNGQSPK
E
CLRLWLSNGIQAPDVYCV
GFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVKLIRLVGIMLL
L
YVKQEHAAYISEVEAETVGTGIMGRM
GNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICS
R
MQFCQPDPSLPPLTISNH
DVILWLGDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQLKIQVAAKTVFEG
F
TEGELTFQPTYKYDTGSDDWDT
SEKCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGV
R
VVNDELYRKTLEEIVRSLDKMENANIPSVSLSKRE
FCFQNVKYMQLKVESFTIHNGQVPCHFEFINKPD
E
ESYCKQWLNANPSRGFLLP
DSDVEIDLELFVNKMTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYL
P
SCFGSPIHTLCYMREPILDLPLETISEL
TLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQQEDL
F
QQPGLRSEFEHIRDCLDTGMIDNL
SASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVI
S
TLPIFHKNVFHYLMAFLRELLKNSAKNHLDENIL
ASIFGSLLLRNPAGHQKLDMTEKKKAQEFIHQFLC
N
PL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser