NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41205.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41205.1 Public Mus musculus X Zrsr2 21 106 86 CCDS HistoryNCBI Gene:22184Re-query CCDS DB by CCDS ID:41205.1Re-query CCDS DB by GeneID:22184See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41205.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000090840 ENSMUSP00000088350 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000090840Link to Ensembl Protein Viewer:ENSMUSP00000088350Re-query CCDS DB by Nucleotide ID:ENSMUST00000090840Re-query CCDS DB by Protein ID:ENSMUSP00000088350
Original member Current member EBI,WTSI OTTMUST00000046578 OTTMUSP00000021034 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046578Link to Vega Protein Viewer:OTTMUSP00000021034Re-query CCDS DB by Nucleotide ID:OTTMUST00000046578Re-query CCDS DB by Protein ID:OTTMUSP00000021034
Original member Current member NCBI NM_178794.4 NP_848909.2 Accepted alive Link to Nucleotide Sequence:NM_178794.4Link to Protein Sequence:NP_848909.2Re-query CCDS DB by Nucleotide ID:NM_178794Re-query CCDS DB by Protein ID:NP_848909Link to BLAST:NP_848909.2

Chromosomal Locations for CCDS 41205.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 163953546 163953656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 163954374 163954482 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 163956472 163956553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 163957916 163957995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 163958274 163958326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (435 nt):
ATGGAAACGGCGGGGGCTACGGCGGACGCTACGGCGGGGCCGCAGAAACTGAGCCGTAAGAAGTACTTGG
CC
CTCCGGAAGAAGGAGAGACGTAAGAGGCGACGGCAGGCGCTCGCTCGGCTCAGAGAGGCAGAATTGGC
A
CAGAAAGAGGAGGAAGAAGATCCTCTTGCTGAAGAAAAACGACTAGAAGAAGAAAGGTTGTTAGAGGAA
GAG
AGGCAGAGACTGCATGAAGAATGGTTACTGAGGGAAGAAAAGGCACAAGAAGAATTCAGGGCAAAGA
AG
AAAAAAGAAGAGGAAGCTCGAAAACGGAAGGAAGAACTAGAGAGAAAGTTAAAGGCAGAATGGGAAGA
A
CAGCAGAGAAAAGAGCGAGAGGAAGAGGAGCAGAAACGACAAGAGAAGAGAGAAAGAGAGGTGACTTCT
GTC
ATAGGAGGATAG


Translation (144 aa):
METAGATADATAGPQKLSRKKYLALRKKERRKRRRQALARLREAELAQKEEEEDPLAEEKRLEEERLLEE
E
RQRLHEEWLLREEKAQEEFRAKKKKEEEARKRKEELERKLKAEWEEQQRKEREEEEQKRQEKREREVTS
V
IGG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser