NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40793.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40793.1 Public Mus musculus 9 Trim71 23 108 98 CCDS HistoryNCBI Gene:636931Re-query CCDS DB by CCDS ID:40793.1Re-query CCDS DB by GeneID:636931See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40793.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111816.2 ENSMUSP00000107447.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111816.2Link to Ensembl Protein Viewer:ENSMUSP00000107447.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000111816Re-query CCDS DB by Protein ID:ENSMUSP00000107447
Original member Current member NCBI NM_001042503.2 NP_001035968.1 Accepted alive Link to Nucleotide Sequence:NM_001042503.2Link to Protein Sequence:NP_001035968.1Re-query CCDS DB by Nucleotide ID:NM_001042503Re-query CCDS DB by Protein ID:NP_001035968Link to BLAST:NP_001035968.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001035968.1 855 Q1PSW8 855 100% 0 0

Chromosomal Locations for CCDS 40793.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 114512645 114514096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 114515733 114515867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 114524954 114525121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 114562305 114563117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2568 nt):
ATGGCTTCGTTCCCGGAGACCGACTTCCAGATCTGCCTGCTGTGCAAGGAGATGTGCGGCTCGCCCGCGC
CG
CTCTCCTCCAACTCGTCCGCCTCGTCGTCGTCCTCGCAGACTTCCACGTCGTCGGCGGGCGGCGGCGG
C
CCCGGGGCGGCGGCGCGGCGTCTTCACGTCTTGCCCTGCCTGCACGCCTTCTGCCGGCCGTGCCTCGAG
GCG
CACCGGCTGCCCGCTCCCGGAGGCGCGGGCCCCGCCGAGGCGCTGAAGCTGCGCTGCCCCGTATGTG
AC
CAGAAGGTGGTCCTGGCCGAGGCGGCGGGCATGGACGCGCTGCCATCCTCCGCCTTCCTGCTCAGCAA
C
CTGCTGGACGCCGTGGTGGCCACCGCCGAAGAGCCGCCGCCCAAGAACGGGCGCGCGGGCGGCGGCCCC
GGG
GGCGCGGGCGGCCACAGCAACCACCGGCACCATGCGCACCACCCGGCCCAGCGCGCCGCCGCTCCAG
CG
CCGCAGCCGCCGCCCGGCCCGGCCGCCTCCCCCGGGTCGCTGCTGATGCGCCGGCCGCACGGCTGCAG
C
TCCTGCGACGAGGGCAACGCCGCCTCGTCGCGCTGCCTCGACTGCCAGGAACACCTGTGCGACAACTGT
GTC
CGCGCGCACCAGCGCGTCCGCCTCACCAAGGACCATTACATCGAGCGCGGCCCTCCGGGGCCTGCGG
CC
GCCTCCGCGGCACAGCAGCTGGGGCTCGGGCCGCCCTTCGCGGGCGCGCCCTTCTCCATTCTCTCGGT
G
TTCCCGGAGCGCCTCGGCTTCTGCCAGCACCACGACGATGAGGTCCTGCATCTCTACTGTGACACCTGC
TCT
GTCCCCATCTGCAGAGAGTGCACGCTGGGCCGCCACGGTGGCCACAGCTTCGCCTACCTCCAGGATG
CC
CTGCAGGACTCTCGGGCACTCACCATCCAGCTGCTGGCTGATGCCCAGCAGGGCCGCCAGGCTCTCCA
G
CTGAGCATCGAGCAGGCCCAGACTGTGGCAGAACAGGTGGAGATGAAGGCGAAGGTGGTCCAGTCTGAG
GTC
AAGGCCGTCACAGCTCGCCACAAGAAGGCCCTGGAGGATCGGGAGTGTGAGCTGTTGTGGAAGGTGG
AG
AAGATCCGGCAGGTGAAGGCGAAGTCTCTGTTCCTGCAGGTGGAGAAGCTGCGGCAGAGTCTCAGCAA
G
CTGGAGAGCACCATCAGCGCCGTGCAGCAGGTCCTGGAAGAGGGCCGCGCCCTGGACATCCTGCTGGCC
CGA
GACCGGATGCTGGCCCAGGTGCAGGAGCTCAAGACCATCCGAGGCCTCCTGCAGCCCCAAGAAGATG
AC
CGCATTATGTTCACGCCCCCTGACCAGGCCCTGTACCTCGCCCTCAAGTCTATTGGCTTTGTCAGCAG
C
GGGGCCTTCGCCCCGCTCACGAAGGCTACAGGAGATGGCATCAAGCGTGCCCTTCAGGGGAAGGTGGCC
TCT
TTCACTGTCATGGGCTACGACCACGATGGTGAGCCCCGCCATTCGGGAGGTGACCTGATGTCAGTTG
TG
GTCCTCGGCCCCGACGGAAACCTGTTTGGTGCAGAAGTGAGCGACCAGCAGAATGGTACTTACATAGT
G
AGCTACAGGCCCCAGCTTGAGGGTGAGCACTTGGTGTCGGTGACATTGTACAATCAGCATATAGAGAAC
AGC
CCCTTCAAGGTCGTGGTCAAGTCGGGCCGCAGCTACGTGGGCATCGGGCTCCCCGGGCTGAGCTTCG
GC
AGTGAAGGTGACGGGGAGGGCAAGCTCTGCAGGCCCTGGGGCGTGAGTGTTGATAAGGAGGGTTTCAT
C
ATAGTGGCTGACCGAAGCAATAACAGAATCCAGGTGTTTAAGCCCTGTGGTTCCTTCCACCACAAGTTT
GGT
ACCCTTGGGTCTCGTCCTGGGCAGTTTGACCGACCGGCTGGGGTGGCTTGTGACGCCTCCCGCAGGA
TC
ATAGTGGCCGACAAAGACAATCATCGCATTCAGATCTTCACCTTCGAGGGCCAGTTCCTTCTTAAGTT
T
GGTGAGAAAGGCACCAAGAACGGGCAGTTTAACTACCCGTGGGATGTAGCAGTGAATTCTGAGGGCAAG
ATC
CTCGTTTCAGACACCCGGAATCATCGCATCCAGTTGTTCGGACCGGACGGGGTCTTCCTGAACAAGT
AC
GGCTTCGAGGGATCTCTCTGGAAGCACTTCGACTCTCCACGGGGCGTGGCTTTCAACAATGAAGGTCA
C
CTGGTAGTCACCGACTTCAACAACCACCGGCTTCTGGTTATTCACCCTGATTGCCAATCTGCCCGCTTC
TTG
GGTTCGGAGGGCTCGGGCAATGGGCAGTTCCTGCGACCACAGGGTGTGGCTGTGGACCAGGAAGGGA
GA
ATCATCGTAGCCGATTCCAGAAATCACCGCGTGCAGATGTTTGAGGCCAATGGCAGCTTCCTGTGCAA
G
TTTGGTGCTCAAGGGAGTGGCTTCGGGCAGATGGACCGCCCCTCAGGTATCGCGGTCACCCCGGATGGA
TTG
ATCGTCGTGGTGGACTTTGGCAACAATCGAATCCTCATCTTCTAA


Translation (855 aa):
MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSAGGGGPGAAARRLHVLPCLHAFCRPCLE
A
HRLPAPGGAGPAEALKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLLDAVVATAEEPPPKNGRAGGGP
G
GAGGHSNHRHHAHHPAQRAAAPAPQPPPGPAASPGSLLMRRPHGCSSCDEGNAASSRCLDCQEHLCDNC
V
RAHQRVRLTKDHYIERGPPGPAAASAAQQLGLGPPFAGAPFSILSVFPERLGFCQHHDDE
VLHLYCDTC
S
VPICRECTLGRHGGHSFAYLQDALQDSRALTIQLLADAQQGRQALQ
LSIEQAQTVAEQVEMKAKVVQSE
V
KAVTARHKKALEDRECELLWK
VEKIRQVKAKSLFLQVEKLRQSLSKLESTISAVQQVLEEGRALDILLA
R
DRMLAQVQELKTIRGLLQPQEDDRIMFTPPDQALYLALKSIGFVSSGAFAPLTKATGDGIKRALQGKVA
S
FTVMGYDHDGEPRHSGGDLMSVVVLGPDGNLFGAEVSDQQNGTYIVSYRPQLEGEHLVSVTLYNQHIEN
S
PFKVVVKSGRSYVGIGLPGLSFGSEGDGEGKLCRPWGVSVDKEGFIIVADRSNNRIQVFKPCGSFHHKF
G
TLGSRPGQFDRPAGVACDASRRIIVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGK
I
LVSDTRNHRIQLFGPDGVFLNKYGFEGSLWKHFDSPRGVAFNNEGHLVVTDFNNHRLLVIHPDCQSARF
L
GSEGSGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFEANGSFLCKFGAQGSGFGQMDRPSGIAVTPDG
L
IVVVDFGNNRILIF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser