NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40781.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40781.2 Public Mus musculus 9 Setd2 23 108 98 CCDS HistoryNCBI Gene:235626Re-query CCDS DB by CCDS ID:40781.2Re-query CCDS DB by GeneID:235626See the combined annotation on chromosome 9 in Sequence Viewer

Public Note for CCDS 40781.2
The coding region has been updated to extend the N-terminus to one that is more supported by available conservation data.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 40781.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000153838.7 ENSMUSP00000116313.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000153838.7Link to Ensembl Protein Viewer:ENSMUSP00000116313.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000153838Re-query CCDS DB by Protein ID:ENSMUSP00000116313
Original member Current member NCBI NM_001081340.2 NP_001074809.2 Accepted alive Link to Nucleotide Sequence:NM_001081340.2Link to Protein Sequence:NP_001074809.2Re-query CCDS DB by Nucleotide ID:NM_001081340Re-query CCDS DB by Protein ID:NP_001074809Link to BLAST:NP_001074809.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074809.2 2537 E9Q5F9-1 2537 100% 0 0

Chromosomal Locations for CCDS 40781.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 110532679 110532752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110545300 110545315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110547209 110551494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110553103 110553234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110556288 110556416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110561116 110561239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110562937 110563014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110564571 110564668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110567708 110567834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110569677 110569811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110571947 110572066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110573612 110574274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110590388 110590436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110592399 110592579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110594091 110594760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110599119 110599253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110602123 110602262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110604120 110604231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110614870 110614950 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110617434 110617535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 110617818 110617979 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7614 nt):
ATGAAGCCGCTGCCGTCGCAGCAGCCGCCACCGAAGATGGGGGATTTCTACGATCCCGAGCACCCGACCC
CT
GAAGAAGAAGAAAATGAGGCAAAGATTGAAAATGTGCAGAAAACAGGTTTCATCAAAGGACCAGTGTT
C
AAAGGTGTTGCTTCAAGTCGATTTTTGCCCAAAGGCACGAAGACAAAAGTTAATTTGGAGGAACAGGGA
CGG
CAAAAGGTGTCATTCAGCTTCAGTTTTACAAAGAAAACTTTACAGAATAGATTTCTCACTGCGCTTA
GC
AATGAAAAGCAAAGTGATTCTCCAAACTCCCCAGCTCCCCCTCTTCAAGTAGACTCAAACCCTAAAGT
T
AAAATGGACGCTGGAGATACTTTTCCTGCTACAGAAGAATCTTCGCCACCAAAATCGAGAGTGGAATTG
GGC
AGAATTCATTTTAAGAAACATTTGCTTCATGTGACATCTAGGCCACAGCTGGCTGCAAGTACAACAG
CA
GCATCTCCCCTTCCTCCTACAACACAGTTACCAGCAGTCTTAGCAGAGTCGATGATAGACTCACCACC
T
TCATCTCCACCCCCACCTCCTCCACCTCCCCAGGCCTCATCACCCTCACCACCAGCACAGATATCAGAG
CCA
GTGGCCTTGCCGCAACCCCCAGCAACAGCACTAATGACATCACCACCAGGACCTTTACCAGGAGACG
TA
GCCGTGAGAGCTCAGAAAGAATCACCAGTTAAAAGTGGACCCGAAGTTTTAGAGGTGGATACAAAGCA
A
GATATTGTATCTAATAGTTTGGAAGAACACACAGTTCAAACTTTGAAGGAACAAGCAGATCATCTCCTG
CAA
AAAGAAGATTCCCATATTGGGAAGGAAGAAGAGGTTTCAGATGGCTCTAAGATAAGCCTCAGTTCTA
AA
AAAGCAAGTTCTAAGAAGAAATCTTCACAATTTGAAGGCACATTTCTTGGTTCAGAGTCTGATGAAGA
T
TCTGTACGGACTTCTTCCAGTCAAAGATCACATGATTTAAAATCTTCAACAAGCATTGACAAGGAAAGA
GAT
TTTAAGAAGAGCTCAGCACCTTCAAAAAGTGAGGATTTGGGGAAATCATCAAGATCGAAAACAGAGA
GA
GATGATAGATATTGTAGCTACTCAAAACTTGAACGAGATACTCGGTATGTATCTTCCCGATGTCGGTC
C
GAAAGAGATCGAAGGCGAAGCCGATCTCGTTCTAGATCTGACAGAGCCTCTAGAACTAGTTTGTCTTAT
TCT
CGCTCAGAAAGATCTCATTATTATGATTCTGAACGGCGCTACCATAGGAGTTCCCCTTATCGTGAGA
GG
ACACGCTATTCTCGGCCATATACTGATAACAGGGCACGGGAGAGCTCAGACTCTGAAGATGAGTATAA
G
AAGACATACCCACGGCGTACCTCAGCCCATTCCTACAGAGACCTAAGGACATCATCATCTTACTCTAAA
TTT
GATCGGGACTGTAAAACTGAGACCTCTTACTTAGAGATGGAGAGAAGAGGAAAGTATACTTCAAAAC
TA
GAAAGAGAATCCAAACGGACTTCAGAGCATGAAACCATAAAAAGATGTTGTTCTCCCCCAAATGAACT
G
GGATTCCGACGGGGGTCATCATATTCCAAGCATGATAACAGTACTTCCCGTTATAAATCTGCCCTTTCA
AAA
TCTATATCCAAGAATGATAAATTTAAAAATTCTTTCTGTTGTACAGAATTAAATGAGGAAAACAAAC
AA
TCTCATTCGTTTAGTTTGCAGACTCCTTGTTCAAAAGGTAGTGAATTAAGAACAATTAATAAGATTTC
T
GAAAGAGAAAAGACTGGGTCTCCAACTCCATCAAATCAATTAAACGATTCACCTACTTTTAAAAAGCTA
GAT
GAATCTCCTGTTCTTAAGCCTGAATTTATAGGACACGATGGCCGTGAAAGTATTAAAGAATTGGAGT
TA
TCAAAAGTGAAAAATGATCAATTAAGAAATTTTTGTTCCATTGAATTAAATGTAAACGGATCTCCAGA
G
ACAGAAGCTGATGTGGCAACATTTTGTACTTCTAAGACAGATGCTATATCAATGACTTCTGATGATAGT
GTG
ACTGGATCAGAGGTATCCCCTTTGATCAAGGCTTGCATGCTTTCATCAAATGGATTTCAGAATGTTG
GT
AGATGCAGAGAAAGGGACTCAGATGATACTTGTAGGCAGCATAATACGTCAAAAAGTCCATTTAGGGA
A
ATGGAACCTTTGTTGTCACCACACCATGATAAACTCATGTCTTTGCCAGTTAAGACTATAGATTATCCC
AAA
ACATTAATTAAAGAACCAGTTGATAAGAGACATTCTTGCTGCAAAACCAAAGATTCAGATATATACT
GT
TCTCCAAATGAAAACCCTGAAGCTGAGAACGCTGAACCTTCAGCTATGACGATTTCTTCACATAGCTT
T
GTGAATGTGCATTTGGAATCCAAGACAGTTATATGTGATAATAGGGAGCCGACAGACCGGCACTCAGAG
AAT
ACATGTGATGAATATAAGCAGAGCATTGGTAGCACTAGTTCAGCTTCTCATAACCATTTTGATGGTT
TG
TATGAGCCTATAGGGAGTTCAGGTATTTCATCTCTCCAGAGTCCTCCGTCAGGAATAAGATGTGAAGA
A
AACACATCTCCAACTCTAGATGCAGTGGAGAGTAAAAAAGGCATAGATTTTTTAAAGTATGCACGGAAA
GAA
ACAGATGTTGGTAGTGCCCTTCCTGATTCAGGAAAAGGATTTTCTTGGGAAAACAGGCATAATAATG
TG
TTATCTGGGCAGTCTTTGCAAGAGGCTCAAGAAGAAGGGAATTCCATATTGCATGAGAGAAGAGGAAG
A
CCAGAAATCCCCTTAGATGAGGAACAAAGAGGCCATACACATATTTCTGATGATTCAGAAGTGGTATTT
CCT
TATGATTTGAACTTGACCATGGAAGACAGTGATGGTATAACCTACACCTTAAAATGTGATAGTAGTG
GA
AATGCTCCAGAGATTGTATCTACTGTCCATGAAGACTATTCTGGATCTTCTGCAAGTTCAAGCGATGA
A
AGTGATTCTGAAGATACAGAGTCTGATGATAGCAGTATTCCAAGAAACCGACTCCAGTCTGTTGTGGTT
GTG
CCAAAGAATTCTACTTTGCCCATGGAAGAGACAAGTCCCTGTTCTTCTCGGAGCAGTCAGAGCTACA
AA
CATTATTCTGACCGCTGGGAAGATGGATTAGAGACCAGGAGACATGCATATGAGGAAGAGTATGAGAG
T
AAAGGCTGTTCTCAAACTGAAAAATACTTCCTTCATAAAGGAACAGAGAGAAGTGCAGAAAGTTGTTAT
TCA
CAGTTTGGCAGGAAAGCAGATAATCACCTGCCTGACATTGCTCATGCTCAGAGTGACGGGGTTGATA
GT
ACAAGTCAGACAGACTCGAGATCTGACCATCTAGGTCACCTGAATCCAGAGGACACATTAAGAGCCAA
A
ACATCTAGGCCACAAGAGCTACCAGTTTATTCTGACGATTTTGAAGATCTCCCAAATAAGTCTCGGCAG
CAG
ATGATTTTCTCTAATCGGCCAGATAGTAGTAGACTAGGAAAAACAGAGCTGAGTTTTTCTTCCTCTT
GT
GACATTTCCCGAATGGATGGCTTGCACTCATCAGAAGAGCTCAGAAACCTAGGGTGGGACTTTTCCCA
A
CAGGAAAGGCCCACCACCACATACCAGCAGCCTGACAGCAGCTATGGAACCTGTGGTACACATAAGTAT
CAA
CAAAGTACTGAACACTATGGTGGGACCCATAATTACTGGCAAGGCAATGGCTATTGGGATCCAAGAT
CA
GCAGGTAGACCTCCAGGAACTGGGCTTGCTTATGATCGAATCCAAGGGCAAGTACCAGATTCTCTAAC
A
GACGATCGTGAAGAAGAGGAACATTGGGATCAACGAAGTGGATCACATTTTTCAAGCCCGTCCAATAAA
TTT
TTCTTCCATCAGAAGGACAAGGGATCAGTGCAAGCACCGGAAATAAGCAGCAATTCAATTAAAGACG
CT
TTAGTTATGAACGAAAGGAAAGATTTTTCGAAAAACTTTGAAAAAAATGATATAAAAGAGAGAGGGCC
T
CCTAAAAAACGAAGGCAAGAGTTGGAGAGTGATTCTGAAAGTGATGGTGAACTACAGGCTAGAAAGAAA
GTT
AGAGTGGAGATGGAGCAGGGAGAATCATCTGTGCCCCAGCACTCAGAACTGATGGGGCCTTCGTGTG
CT
ATGGATGACTTCAGGGACCCACAGCGGTGGAAAGAATTTGCCAAGCTGGGGAAGATGCCATGTTACTT
T
GATCTTATTGAAGAAAATGTTTATTTAACAGAAAGGAAGAAGAACAAATCCCACCGGGATATTAAGCGA
ATG
CAGTGTGAGTGTACACCTCTTTCTAAGGATGAAAGAGCTCAAGGTGAAGTAGCATGTGGAGAAGATT
GC
CTTAATCGTCTCCTCATGATTGAATGTTCCTCTCGATGTCCAAATGGAGATTACTGTTCAAACAGACG
G
TTTCAGAGAAAACAGCATGCAGATGTAGAAGTCATACTTACAGAAAAGAAAGGCTGGGGCTTAAGGGCT
GCT
AAGGATCTTCCTTCGAACACCTTTGTCCTGGAATACTGTGGAGAGGTACTTGATCATAAAGAGTTTA
AA
GCTCGGGTGAAAGAATATGCACGGAACAAAAACATCCACTACTACTTCATGGCCCTGAAAAATGACGA
G
ATAATAGATGCCACTCAAAAAGGGAATTGCTCTCGTTTCATGAATCATAGCTGTGAACCAAACTGTGAA
ACC
CAGAAATGGACTGTGAATGGACAGCTGAGGGTTGGATTTTTTACCACCAAACTAGTTCCTTCAGGCT
CA
GAATTAACTTTTGACTACCAGTTCCAAAGATATGGCAAAGAAGCTCAGAAGTGTTTCTGTGGGTCAGC
C
AACTGCCGGGGCTACTTGGGAGGAGAAAACAGAGTCAGTATCAGAGCTGCAGGAGGGAAGATGAAAAAG
GAA
CGCTCTCGAAAGAAGGATTCAGTGGATGGAGAACTTGAAGCACTGATGGAAAATGGTGAAGGCCTCT
CT
GATAAGAACCAGGTTCTTAGTTTATCCCGGCTCATGGTTAGAATTGAAACTTTGGAACAGAAACTTAC
C
TGTCTTAAGCTCATTCAGAACACACACTCACAGTCCTGCCTCAAGTCATTTCTGGAACGTCATGGGTTG
TCA
CTGTTGTGGATCTGGATGGCAGAGCTTGGCGACGGCCGGGAAAGTAACCAGAAGCTTCAGGAAGAGA
TT
ATAAAGACTTTGGAGCATTTGCCCATTCCTACTAAAAATATGTTGGAAGAAAGCAAAGTACTTCCAAT
T
ATTCAGCGCTGGTCTCAAACTAAGACTGCTGTTCCTCAGTTAAGTGAAGGAGACGGGTATTCTAGTGAG
AAT
ACATCACGTGCTCACACACCGCTTAATACACCGGACCCTTCTGCCAAGCCGAGCACGGAAATGGATA
CA
GATACTCCCAAGAAACTCATATTCCGCAGACTGAAGATTATAAGTGAAAATAGCATGGACAGTGCAGT
C
TCGGACGTCACTAGTGAGCTAGAATGCAAGGATGGCAAAGAGGACCTTGATCAGTTAGAGACTGTCACT
GTG
GAAGAGGATGAAGAGCTGCAGTCCCAGCAGCTCCTCCCACAGCAGCTGTGCGAGTCCAAAGTTGAGA
GT
GAAGCCACTATTGAAGTCAGTAAGTTACCCACATCTGAACCGGAGGCAGACACGGAGACAGAGCCCAA
A
GACAGCAATGGCACAAAACTAGAAGAAACTATTGCTGAGGAAACACCATCCCAAGATGAAGAAGAGGGA
GTG
TCTGATGTTGAAAGTGAGAGAAGCCAGGAGCCACCAGATAAAACAGTGGATATAAGTGATTTGGCTA
CC
AAGTTACTAGACAGTTGGAAAGATCTAAAGGAGGTGTATCGGATTCCAAAGAAAAGTCAAACTGAAAA
G
GAGAGCACAGTAGCTGAACGAGGAAGAGATGCTGCTGCCTTCAGAGATCAAACAGCTCCAAAGACTCCT
AAC
AGGTCTAGAGAGAGAGACCCAGACAAGCAGTCTCAAAATAAAGAGAAAAGGAAACGACGGGGCTCTC
TG
TCACCACCCTCTTCTGCATATGAGCGGGGAACAAAAAGGCCAGATGACAGATATGATACACCAACTTC
T
AAAAAGAAAGTACGAATTAAAGACCGAAACAAACTTTCTACAGAGGAGCGCAGGAAGTTGTTTGAACAA
GAG
GTGGCACAGAGGGAAGCTCAGAAGCAACAGCAACAGATGCAGAACTTGGGGATGACATCACCACTCC
CC
TTTGACTCTCTGGGATATAATGCCTCTCATCACCCCTTTGCTGGGTACCCACCAGGTTACCCCATGCA
A
GCCTATGTGGATCCCAGCAACCCTAATGCTGGAAAGGTGCTTCTGCCCACACCTAGCATGGACCCTGTG
TGC
TCCCCTGCTCCTTATGATCACGCTCAGCCCTTGGTAGGACATTCTACAGAATCCCTTGCTGCTCCCC
CA
TCTGTGCCAGTGGTGCCGCATGTGGCAGCCTCTGTGGAAGTTTCCAGTTCTCAGTATGTAGCTCAGAA
T
GAAAGTGTTGTACACCAAGACTCCAATGTTCCTGTAATGCCAGTACAAGCTCCAGGCCCAGTCCAAGGA
CAG
AATTACAATGTCTGGGAGTCAAACCAACAGTCTGTCAGTGTACAACAGCAGTATTCTCCTGCACAAT
CT
CAAACAACCATATATTATCAAGGACAGACATGTTCAACTGTCTATAGTGTGACCTCGCCTTATTCACA
G
ACAACTCCTCCAATTGTGCAGAGTTATGCCCAGCCAAGTCTTCAGTATATCCAGGGACAGCAGATTTTC
ACA
GCTCACCCACAAGGAGTGGTGGTACAGCCAACTGCAGCCGTGACTTCAATAGTTGCACCAGGGCAGC
CT
CAGTCCTTACAGCCACCTGAAATGGTTGTAACAAATAATCTACTGGACCTGCCACCACCCTCCCCTCC
A
AAACCAAAAACGATTGTTTTACCTCCCAACTGGAAGACAGCCCGAGACCCTGAGGGGAAGATCTACTAC
TAC
CACGTGATCACAAGACAGACTCAGTGGGATCCTCCTACTTGGGAAAGCCCAGGAGATGATGCCAGCC
TT
GAGCATGAAGCTGAAATGGACCTGGGAACCCCAACCTATGATGAAAACCCCATGAAGACATCAAAAAA
G
CCCAAGACAGCAGAAGCAGACACCTCCAGTGAGCTGGCAAAGAAAAGCAAAGAAGTATTCAGAAAAGAG
ATG
TCTCAGTTCATTGTCCAGTGCCTGAATCCTTACCGGAAACCTGACTGCAAGGTGGGCAGGATCACCA
CC
ACTGAAGATTTCAAGCACCTCGCCCGAAAGCTGACTCATGGAGTTATGAATAAGGAGCTGAAGTACTG
T
AAGAACCCCGAGGACCTGGAGTGCAATGAGAATGTGAAACACAAAACCAAGGAGTACATCAAGAAGTAC
ATG
CAGAAGTTTGGGGCTGTTTACAAACCTAAAGAGGACACTGAACTAGAGTGA


Translation (2537 aa):
MKPLPSQQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPVFKGVASSRFLPKGTKTKVNLEEQG
R
QKVSFSFSFTKKTLQNRFLTALSNEKQSDSPNSPAPPLQVDSNPKVKMDAGDTFPATEESSPPKSRVEL
G
RIHFKKHLLHVTSRPQLAASTTAASPLPPTTQLPAVLAESMIDSPPSSPPPPPPPPQASSPSPPAQISE
P
VALPQPPATALMTSPPGPLPGDVAVRAQKESPVKSGPEVLEVDTKQDIVSNSLEEHTVQTLKEQADHLL
Q
KEDSHIGKEEEVSDGSKISLSSKKASSKKKSSQFEGTFLGSESDEDSVRTSSSQRSHDLKSSTSIDKER
D
FKKSSAPSKSEDLGKSSRSKTERDDRYCSYSKLERDTRYVSSRCRSERDRRRSRSRSRSDRASRTSLSY
S
RSERSHYYDSERRYHRSSPYRERTRYSRPYTDNRARESSDSEDEYKKTYPRRTSAHSYRDLRTSSSYSK
F
DRDCKTETSYLEMERRGKYTSKLERESKRTSEHETIKRCCSPPNELGFRRGSSYSKHDNSTSRYKSALS
K
SISKNDKFKNSFCCTELNEENKQSHSFSLQTPCSKGSELRTINKISEREKTGSPTPSNQLNDSPTFKKL
D
ESPVLKPEFIGHDGRESIKELELSKVKNDQLRNFCSIELNVNGSPETEADVATFCTSKTDAISMTSDDS
V
TGSEVSPLIKACMLSSNGFQNVGRCRERDSDDTCRQHNTSKSPFREMEPLLSPHHDKLMSLPVKTIDYP
K
TLIKEPVDKRHSCCKTKDSDIYCSPNENPEAENAEPSAMTISSHSFVNVHLESKTVICDNREPTDRHSE
N
TCDEYKQSIGSTSSASHNHFDGLYEPIGSSGISSLQSPPSGIRCEENTSPTLDAVESKKGIDFLKYARK
E
TDVGSALPDSGKGFSWENRHNNVLSGQSLQEAQEEGNSILHERRGRPEIPLDEEQRGHTHISDDSEVVF
P
YDLNLTMEDSDGITYTLKCDSSGNAPEIVSTVHEDYSGSSASSSDESDSEDTESDDSSIPRNRLQSVVV
V
PKNSTLPMEETSPCSSRSSQSYKHYSDRWEDGLETRRHAYEEEYESKGCSQTEKYFLHKGTERSAESCY
S
QFGRKADNHLPDIAHAQSDGVDSTSQTDSRSDHLGHLNPEDTLRAKTSRPQELPVYSDDFEDLPNKSRQ
Q
MIFSNRPDSSRLGKTELSFSSSCDISRMDGLHSSEELRNLGWDFSQQERPTTTYQQPDSSYGTCGTHKY
Q
QSTEHYGGTHNYWQGNGYWDPRSAGRPPGTGLAYDRIQGQVPDSLTDDREEEEHWDQRSGSHFSSPSNK
F
FFHQKDKGSVQAPEISSNSIKDALVMNERKDFSKNFEKNDIKERGPPKKRRQELESDSESDGELQARKK
V
RVEMEQGESSVPQHSELMGPSCAMDDFRDPQRWKEFAKLGKMPCYFDLIEENVYLTE
RKKNKSHRDIKR
M
QCECTPLSKDERAQGEVACGEDCLNRLLMIE
CSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRA
A
KDLP
SNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCE
T
QK
WTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKK
E
RSRKKDS
VDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGL
S
LLWIWMAELGDGRESNQKLQEE
IIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPQLSEGDGYSSE
N
TSRAHTPLNTPDPSAKPSTEMDTDTPKKLIFRRLKIISENSMDSAVSDVTSELECKDGKEDLDQLETVT
V
EEDEELQSQQLLPQQLCESKVESEATIEVSKLPTSEPEADTETEPKDSNGTKLEETIAEETPSQDEEEG
V
SDVESERSQEPPDKTVDISDLATKLLDSWKDLK
EVYRIPKKSQTEKESTVAERGRDAAAFRDQTAPKTP
N
RSRERDPDKQSQNKEKRKRRGSLSPPSSAYERGTKRPDD
RYDTPTSKKKVRIKDRNKLSTEERRKLFEQ
E
VAQREAQKQQQQMQNLGMTSPLPFDSLGYNASHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPV
C
SPAPYDHAQPLVGHSTESLAAPPSVPVVPHVAASVEVSSSQYVAQNESVVHQDSNVPVMPVQAPGPVQG
Q
NYNVWESNQQSVSVQQQYSPAQSQTTIYYQGQTCSTVYSVTSPYSQTTPPIVQ
SYAQPSLQYIQGQQIF
T
AHPQGVVVQPTAAVTSIVAPGQPQSLQP
PEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYY
Y
HVIT
RQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKE
M
SQFIVQCLNPYRKPDCKVGRITTTEDFKHLARK
LTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKY
M
QKFGAVYKPKEDTELE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser