NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40706.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40706.1 Public Mus musculus 9 Phip 23 108 98 CCDS HistoryNCBI Gene:83946Re-query CCDS DB by CCDS ID:40706.1Re-query CCDS DB by GeneID:83946See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40706.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000034787.11 ENSMUSP00000034787.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000034787.11Link to Ensembl Protein Viewer:ENSMUSP00000034787.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000034787Re-query CCDS DB by Protein ID:ENSMUSP00000034787
Original member Current member NCBI NM_001081216.1 NP_001074685.1 Accepted alive Link to Nucleotide Sequence:NM_001081216.1Link to Protein Sequence:NP_001074685.1Re-query CCDS DB by Nucleotide ID:NM_001081216Re-query CCDS DB by Protein ID:NP_001074685Link to BLAST:NP_001074685.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074685.1 1821 Q8VDD9 1821 99.8902% 0 2

Chromosomal Locations for CCDS 40706.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 82871224 82871861 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82875290 82875487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82876009 82876268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82876726 82876889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82877190 82877342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82880112 82880261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82881321 82881371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82881670 82881739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82884833 82884958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82886622 82886742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82887514 82887669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82890114 82890175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82890361 82890472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82893323 82893405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82893525 82893649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82894234 82894341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82896022 82896141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82900622 82900853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82903124 82903200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82905649 82905789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82906941 82907058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82908691 82908874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82909787 82909924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82913688 82913913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82915296 82915424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82926397 82926531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82927035 82927188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82928100 82928198 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82928829 82928869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82928975 82929075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82930304 82930374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82932486 82932586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82932846 82933067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82945758 82945918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82959512 82959610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82959701 82959851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82974674 82974733 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82974927 82974956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82975088 82975146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 82975252 82975291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5466 nt):
ATGTCTCGTGAGAGGAAAGGCCTCTCGGAGCTGCGATCGGAGCTCTACTTCCTCATCGCCCGGTTCCTGG
AA
GATGGACCCTGTCAGCAGGCGGCTCAGGTGCTGATCCGCGAAGTGGCCGAGAAGGAGCTGCTGCCCCG
G
CGCACCGACTGGACCGGGAAGGAGCACCCCAGGACCTACCAGAATCTGGTGAAGTATTATAGACACCTT
GCA
CCTGATCACTTGCTGCAAATATGTCATCGGCTAGGACCTCTTCTTGAGCAAGAAATTCCTCAGAGTG
TT
CCTGGAGTACAGACTTTACTAGGAGCTGGAAGACAGTCCTTGCTACGAACAAATAAAAGCTGCAAGCA
T
GTGGTATGGAAAGGATCTGCCCTGGCTGCACTGCACTGTGGGAGGCCGCCAGAGTCTCCAGTTAACTAC
GGT
AGCCCACCTAGCATTGCGGATACTCTGTTTTCAAGGAAGCTGAATGGGAAATACAGACTTGAACGAC
TT
GTTCCAACTGCAGTTTATCAGCACATGAAGATGCATAAGCGAATTCTTGGACACTTATCATCGGTGTA
C
TGTGTAACTTTTGATCGAACTGGCAGGCGGATATTTACTGGTTCTGATGATTGTCTTGTGAAAATCTGG
GCC
ACAGACGATGGAAGATTGCTAGCTACTTTAAGAGGACATGCTGCTGAAATATCAGACATGGCTGTAA
AC
TATGAGAATACTATGATAGCAGCTGGAAGTTGTGATAAAATGATTCGTGTCTGGTGTCTTCGAACCTG
T
GCACCTTTGGCTGTTCTTCAGGGACATAGTGCATCTATTACATCACTACAGTTCTCACCATTGTGCAGT
GGC
TCAAAGAGATACCTGTCTTCTACAGGGGCGGACGGCACTATTTGCTTTTGGCTTTGGGATGCTGGAA
CC
CTTAAAATAAATCCAAGACCCACAAAATTTACAGAGCGTCCTCGGCCTGGAGTGCAAATGATATGTTC
T
TCGTTCAGTGCTGGTGGGATGTTTTTGGCCACTGGAAGCACTGACCATATTATTAGAGTTTATTTTTTT
GGA
TCAGGTCAGCCAGAAAAAATATCAGAATTGGAGTTTCATACTGACAAAGTTGACAGTATCCAGTTTT
CC
AACACTAGTAACAGGTTTGTGAGTGGTAGTCGTGATGGGACAGCACGAATTTGGCAGTTTAAACGAAG
G
GAATGGAAAAGCATTTTGTTAGATATGGCTACTCGTCCAGCAGGCCAAAATCTTCAAGGCATAGAAGAC
AAA
ATCACAAAAATGAAAGTAACTATGGTAGCTTGGGATCGACATGACAACACAGTTATAACTGCAGTTA
AT
AACATGACTCTGAAAGTTTGGAATTCTTATACTGGTCAACTGATACATGTTCTAATGGGTCATGAAGA
T
GAGGTGTTTGTTCTTGAGCCACACCCATTTGATCCTAGAGTTCTCTTCTCTGCTGGTCATGATGGAAAT
GTG
ATAGTGTGGGATCTAGCAAGAGGAGTCAAAGTTCGATCTTATTTCAATATGATTGAAGGACAAGGAC
AT
GGTGCAGTGTTTGACTGCAAATGCTCCCCTGATGGTCAGCACTTTGCATGTACAGACTCTCATGGACA
T
CTTTTAATTTTTGGTTTTGGGTCCAGTAGCAAGTATGACAAGATAGCAGATCAGATGTTTTTTCACAGT
GAT
TATCGGCCTCTTATCCGTGATGCGAACAATTTTGTATTAGATGAGCAGACGCAGCAGGCACCTCACC
TC
ATGCCTCCCCCTTTTCTGGTTGATGTTGATGGAAATCCTCATCCATCAAGGTACCAGCGATTGGTTCC
T
GGTCGGGAGAACTGCAGGGAGGAGCAGCTCATTCCTCAGATGGGAGTAACTTCTTCAGGATTGAACCAA
GTT
TTGAGCCAGCAAGCAAACCAGGATATTAGTCCTTTAGACAGCATGATTCAAAGACTGCAGCAGGAGC
AG
GACCTGAGGCGTTCGGGTGAAGCAGGTGTTAGTAATGCCAGCCGTGTGAACAGAGGCTCAGTAAGTTC
T
ACCTCCGAAGTTCATTCACCACCAAATATAGGATTAAGGCGCAGTGGCCAAATCGAAGGTGTACGGCAG
ATG
CACAGCAATGCTCCGAGAAGTGAAATAGCCACAGAGCGAGATCTTGTTGCTTGGAGTCGGAGGGTAG
TA
GTGCCTGAGCTCTCGGCTGGTGTGGCTAGTAGACAAGAAGAATGGAGAACTGCAAAGGGAGAAGAGGA
A
ATAAAGAGTTATAGATCAGAAGAGAAAAGGAAACACTTAACTGTTGCAAAAGAGAATAAAATACTTACT
GTC
TCAAAGAATCATGCTCATGAGCATTTCCTGGATCTTGGGGATTCTAAAAAGCAGCAAGCGAATCAGC
AC
AATTACCGTACAAGATCTGCACTGGAAGAAACACCCAGGCCCTTAGAGGAGCTAGAAAACGGAACTAG
T
TCTTCAGATGAAGGTGAAGTACTTGCTGTCAGTGGTGGGACTTCTGAGGAAGAGGAGCGAGCATGGCAC
AGT
GATGGCAGCTCCAGTGACTACTCCAGTGATTATTCTGATTGGACAGCAGATGCTGGAATTAACTTGC
AG
CCACCAAAGAAAGTTCCTAAGCATAAAACCAAGAAACCAGAAAGTAGTTCAGATGAAGAAGAAGAATC
T
GAAAACCAGAAGCAAAAACATATTAAAAAGGAAAGAAAAAAAGCAAATGAAGAAAAAGATGGACCAACA
TCA
CCAAAGAAAAAAAAGCCCAAAGAAAGAAAACAAAAGAGATTGGCTGTAGGAGAACTAACTGAGAATG
GC
CTAACGTTAGAAGAGTGGTTGCCTTCAGCTTGGATTACAGACACACTTCCCAGGAGATGTCCATTTGT
G
CCACAGATGGGTGATGAGGTTTATTATTTTCGACAAGGGCATGAAGCATATGTTGAAATGGCCCGGAAA
AAT
AAAATTTATAGTATCAATCCTAAAAAGCAGCCATGGCATAAGATGGAACTAAGGGAACAAGAACTAA
TG
AAAATTGTTGGTATAAAGTATGAAGTGGGGTTGCCTACCCTTTGCTGCCTTAAACTTGCTTTTCTAGA
T
CCTGATACTGGCAAACTGACCGGTGGATCATTTACCATGAAATACCATGATATGCCTGACGTCATAGAT
TTT
CTAGTCTTGAGACAACAATTTGATGATGCAAAGTATAGACGATGGAATATAGGTGACCGCTTCAGAT
CT
GTCATAGATGATGCCTGGTGGTTTGGAACAATTGAAAGTCAAGAGCCTCTTCAACCTGAGTACCCTGA
T
AGTTTGTTTCAGTGTTATAATGTATGTTGGGACAATGGAGATACAGAAAAGATGAGTCCTTGGGATATG
GAA
TTAATACCTAATAATGCTGTCTTTCCAGAAGAACTGGGTACCAGTGTTCCTTTAACTGATGTTGAAT
GT
AGGTCGCTAATTTATAAACCTCTTGATGGAGAATGGGGAGCCAATCCCAGGGATGAAGAATGTGAAAG
A
ATTGTTGGAGGAATAAATCAGCTGATGACACTAGATATTGCGTCTGCATTTGTTGCCCCTGTGGACCTT
CAA
GCTTATCCCATGTATTGCACTGTGGTGGCCTATCCAACGGATCTAAGTACAATTAAACAAAGACTGG
AG
AACAGGTTTTACAGGCGCTTTTCATCACTAATGTGGGAAGTTCGATATATAGAACATAATACACGAAC
A
TTCAATGAGCCAGGAAGCCCAATTGTGAAATCTGCTAAATTTGTGACTGATCTTCTCCTGCATTTTATA
AA
G
GATCAGACTTGTTATAACATAATTCCACTTTACAACTCAATGAAGAAGAAAGTTTTGTCTGACTCTG
AG
GAAGAAGAGAAAGATGCTGATGTTCCAGGGACTTCTACCAGAAAGCGCAAGGATCATCAACCTAGAAG
A
AGGTTACGCAACAGAGCTCAGTCTTACGATATTCAGGCATGGAAGAAACAATGTCAAGAATTACTGAAT
CTC
ATATTTCAATGTGAAGACTCAGAACCTTTTCGACAGCCAGTGGATCTTCTTGAATATCCAGACTACA
GA
GACATCATTGACACTCCAATGGACTTTGCCACTGTTAGAGAGACTTTAGAGGCTGGGAATTATGAGTC
A
CCCATGGAGTTATGTAAAGATGTCAGGCTCATTTTCAGTAATTCTAAAGCATACACACCAAGCAAGAGA
TCA
AGGATTTACAGCATGAGTTTACGCCTGTCTGCTTTCTTTGAAGAACATATTAGTTCAGTTTTGTCAG
AT
TATAAATCTGCTCTTCGTTTTCATAAAAGAAACACCATAAGCAAGAAGAGGAAGAAGCGAAACAGGAG
C
AGTTCCCTGTCCAGCAGTGCTGCCTCAAGCCCTGAAAGGAAAAAAAGGATCTTAAAACCCCAGCTAAAG
TCA
GAAGTATCTACCTCTCCATTCTCCATACCTACAAGATCAGTACTACCAAGACATAATGCTGCGCAAA
TG
AATGGTAAACCAGAATCCAGTTCTGTGGTTCGAACTAGGAGCAACCGTGTAGCTGTAGATCCAGTTGT
C
ACCGAGCAGCCCTCTACATCATCAGCCACAAAAGCTTTTGTTTCAAAAACTAATACATCTGCCATGCCA
GGA
AAAGCAATGCTAGAGAATTCTGTGAGACATTCCAAAGCCTTGAGCACACTTTCCAGCCCTGATCCGC
TC
ACATTCAGCCATGCTACAAAGAATAATTCTGCAAAAGAAAACATGGAAAAGGAAAAGCCTGTCAAACG
T
AAAATGAAGTCTTCTGTGTTTTCAAAAGCATCTCCACTTCCAAAGTCAGCCGCAGTCATAGAGCAAGGA
GAG
TGTAAGAACAATGTTCTTATACCAGGAACCATTCAAGTAAATGGCCATGGAGGACAACCATCAAAAC
TC
GTGAAGAGAGGACCTGGGAGGAAGCCCAAGGTAGAAGTTAACACCAGCAGTGGTGAAGTGACACACAA
G
AAAAGAGGTAGAAAGCCCAAGAATCTGCAGTGTGCAAAGCAGGAAAACTCTGAGCAAAATAACATGCAT
CCC
ATCAGGGCTGACGTGCTTCCTTCTTCAACATGCAACTTCCTTTCTGAAACTAATGCTGTCAAGGAGG
AT
TTGTTACAGAAAAAGAGTCGTGGAGGCAGAAAACCCAAAAGGAAGATGAAAACTCACAACCTAGATTC
A
GAACTCATAGTTCCTACAAATGTTAAAGTGTTAAGGAGAAGTAACCGGAAAAAAACAGATGATCCTATA
GAT
GAGGAAGAGGAGTTTGAAGAACTCAAAGGCTCTGAGCCTCACATGAGAACTAGAAATCAGGGTCGAA
GG
ACAGCTTTCTATAATGAGGATGACTCGGAGGAAGAACAGAGACAGCTGTTGTTCGAGGACACCTCCTT
G
ACATTTGGAACTTCTAGTAGAGGACGAGTCCGAAAGTTGACTGAAAAAGCAAAGGCTAATTTAATTGGT
TGG
TAA


Translation (1821 aa):
MSRERKGLSELRSELYFLIARFLEDGPCQQAAQVLIREVAEKELLPRRTDWTGKEHPRTYQNLVKYYRHL
A
PDHLLQICHRLGPLLEQEIPQSVPGVQTLLGAGRQSLLRTNK
SCKHVVWKGSALAALHCGRPPESPVNY
G
SPPSI
ADTLFSRKLNGKYRLERLVPTAVYQHMKMHKRILGHLSSVYCVTFDRTGRRIFTGSDDCLVKIW
A
TDDGRLLATLRGHAAEISDMAVNYENTMIAAGSCDKMIRVWCLRTCAPLAVLQGHSASITSLQ
FSPLCS
G
SKRYLSSTGADGTICFWLWDAGTLKI
NPRPTKFTERPRPGVQMICSSFSAGGMFLATGSTDHIIRVYFF
G
SGQPEKISELEFHT
DKVDSIQFSNTSNRFVSGSRDGTARIWQFKRREWKSILLDMATRPAGQNLQGIED
K
ITKMKVTMVAWDRHDNTVITAVNNMTLKVWNSYTGQLIHVLM
GHEDEVFVLEPHPFDPRVLFSAGHDGN
V
IVWDLARGVKVRSYFNM
IEGQGHGAVFDCKCSPDGQHFACTDSHGHLLIFGFGSSSKYDKIADQMFFHS
D
YRPLIRDANNFVLDEQTQQAPHLMPPPFLVDVDGNPHPSRYQRLVPGRENCREEQLIPQMGVTSS
GLNQ
V
LSQQANQDISPLDSMIQRLQQEQDLRRSGEAGVSNASRVNR
GSVSSTSEVHSPPNIGLRRSGQIEGVRQ
M
HSNAPRSEIATERDLVAWSRRVVVPELSAGVA
SRQEEWRTAKGEEEIKSYRSEEKRKHLTVAKENKILT
V
SK
NHAHEHFLDLGDSKKQQANQHNYRTRSALEETPRPLEELENGTSSSDEGEVLAVSGGTSEEEERAWH
S
DGSS
SDYSSDYSDWTADAGINLQPPKKVPKHKTKKPESSSDEEEESENQKQKHIKKERKKANEEKDGPT
S
PKKKKPKERKQK
RLAVGELTENGLTLEEWLPSAWITDTLPRRCPFVPQMGDEVYYFRQGHEAYVEMARK
N
KIYSINPKKQPWHKMELR
EQELMKIVGIKYEVGLPTLCCLKLAFLDPDTGKLTGGSFTMKYHDMPDVID
F
LVLRQQFDDAKYRRWNI
GDRFRSVIDDAWWFGTIESQEPLQPEYPDSLFQCYNVCWDNGDTEKMSPWDM
E
LIPNN
AVFPEELGTSVPLTDVECRSLIYKPLDGEWGANPRDEECERIVGGINQLMTLDIASAFVAPVDL
Q
AYPMYCTVVAYPTDLSTIKQRLENRFY
RRFSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFI
K
DQTCYNIIPLYNSMKKKVLSDSEEEEKDADVPGTSTRKRKDHQPRRRLRNRAQSYDIQAWKKQCQELLN
L
IFQCEDSEPFRQPVDLLEYP
DYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKR
S
R
IYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTISKKRKKRNRSSSLSSSAASSPERKKRILKPQLK
S
EVSTSPFSIPTRSVLPRHNAAQMNGKPESSSVVRTRSNRVAVDPVVTEQPSTSSATKAFVSKTNTSAMP
G
KA
MLENSVRHSKALSTLSSPDPLTFSHATKNNSAKENMEKEKPVKRKMKSSVFSKASPLPKSAAVIEQG
E
CKNNVLIPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTSSGEVTHKKRGRKPKNLQCAKQENSEQNNMH
P
IRADVLPSSTCNFLSETNAVKEDLLQKKSRGGRKPKRKMKTHNLDSELIVPTNVKVLRRSNRKKTDDPI
D
EEEEFEELKGSEPHMRTRNQGRRTAFYNEDDSEEEQRQLLFEDTSLTFGTSSRGRVRKLTEKAKANLIG
W




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser