NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40646.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40646.1 Public Mus musculus 9 Man2c1 21 106 86 CCDS HistoryNCBI Gene:73744Re-query CCDS DB by CCDS ID:40646.1Re-query CCDS DB by GeneID:73744See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 40646.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000160147 ENSMUSP00000125478 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160147Link to Ensembl Protein Viewer:ENSMUSP00000125478Re-query CCDS DB by Nucleotide ID:ENSMUST00000160147Re-query CCDS DB by Protein ID:ENSMUSP00000125478
Original member Current member EBI,WTSI OTTMUST00000083515 OTTMUSP00000044899 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000083515Link to Vega Protein Viewer:OTTMUSP00000044899Re-query CCDS DB by Nucleotide ID:OTTMUST00000083515Re-query CCDS DB by Protein ID:OTTMUSP00000044899
Original member Current member NCBI NM_028636.2 NP_082912.1 Accepted alive Link to Nucleotide Sequence:NM_028636.2Link to Protein Sequence:NP_082912.1Re-query CCDS DB by Nucleotide ID:NM_028636Re-query CCDS DB by Protein ID:NP_082912Link to BLAST:NP_082912.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082912.1 1039 Q91W89 1039 100% 0 0

Chromosomal Locations for CCDS 40646.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 57130789 57130889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57131159 57131281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57131532 57131655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57133522 57133592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57135090 57135267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57135445 57135634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57136693 57136799 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57136958 57137068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57137282 57137374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57137469 57137585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57137745 57137840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57137920 57138065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57138397 57138520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57138848 57138969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57139069 57139154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57139246 57139401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57139611 57139708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57139870 57139964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57140199 57140303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57140382 57140538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57140635 57140778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57141101 57141210 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57141306 57141385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57141564 57141712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57141806 57141915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 57141995 57142121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3120 nt):
ATGGCGGCAGCGCCGTTCTTGAAGCACTGGCGCACCACTTTCGAGCGGGTGGAGAAGTTCGTGTCCCCGA
TC
TACTTCACCGACTGTAACCTTCGCGGCAGGCTCTTCGGGGACAGCTGCTCGGTGACACTCTCCAGCTT
C
CTGACGCCCGAGAGGCTTCCCTATGAGAAGGCGGTGCAGCAGAACTTCAGCCCTGCGCAGGTCGGCGAC
AGC
TTCGGACCCACATGGTGGACCTGCTGGTTTCGGGTAGAACTGGTCATCCCTGAAGTTTGGGTGGGCC
AG
GAAGTTCATCTTTGCTGGGAAAGCGATGGAGAAAGCCTTGTCTGGCGTGATGGGGAACCTGTCCAGGG
T
TTGACCAAAGAAGGCGAAAAGACCAGTTATGTCCTGAGCGAGAGGCTGCGAGCATCAGACCCTCGGAGC
TTG
ACTCTCTATGTGGAAGTAGCCTGCAATGGGCTTCTGGGGGCCGGGAAGGGAAGCATGATCGCAGCCC
CT
GACCCAGAGAAGATGTTCCAGCTGAGCCAGGCTAAACTGGCTGTGTTCCACCGGGATGTCCACAGTCT
C
CTGGTGGACCTGGAGCTGTTGCTGGGTGTGGCCAAGGGCCTCGGGGAGGACAGCCAGCGCAGCTTCCAG
GCC
CTGCACACAGCCAACCAGATGGTGAACATATGTGACCCTGCTCAGCCTGAGACTTACCCAGCAGCCA
AA
GCCCTGGCCTCCAAGTTCTTTGGCCAACATGGAGGTGAAAGCCAGCATACCATCCATGCCATGGGACA
C
TGTCACATTGATACAGCCTGGCTTTGGCCCTTCAAGGAGACTGTGAGGAAATGTGCCCGGAGCTGGTCG
ACA
GCTGTGACGCTCATGGAGCAGAACACAGACTTCATCTTTGCCTGCTCTCAGGCACAACAACTTGAAT
GG
GTCAAGAGCCAGTACCCTGGTCTGCATGCCCGGCTCCAGGAGTTTGCCTGCCGAGGACAGTTTGTGCC
T
GTGGGGGGCACCTGGGTAGAAATGGATGGGAACCTTCCCAGTGGAGAGGCCATGGTGAGGCAGTTCCTG
CAG
GGCCAGAACTTCTTTCTGCAAGAGTTTGGGAAGATGTGCTCTGAGTTCTGGCTGCCAGACACGTTTG
GC
TACTCAGCACAGCTCCCCCAGATCATGCAAGGCTGTGGCATCAAGCGCTTCCTGACCCAGAAACTGAG
C
TGGAACTTGGTCAACTCCTTTCCACACCATACCTTTTTCTGGGAGGGGCTGGATGGCTCCCGAGTGCTG
GTC
CACTTCCCACCTGGAGACTCATATGGAATGCAGGGCAGTGTGGAGGAGGTGCTGAAGACTGTGACCA
AC
AACCGGGACAAGGGGCGGACCAACCACAGTGGCTTCCTCTTCGGCTTCGGGGATGGGGGAGGTGGCCC
C
ACACAGACCATGTTGGACCGATTGAAGCGGCTGAGCAACACTGATGGGCTGCCCAGGGTGCAGCTATCT
TCT
CCTGGCCAGCTCTTCACGGCACTGGAGAGAGACTCAGGACAGCTGTGCACATGGGTTGGAGAACTCT
TC
CTGGAACTGCACAATGGCACCTACACTACGCATGCCCAGCTCAAGAAGGGGAACAGAGAATGTGAGCA
G
ATTCTTCATGACGTGGAGGTGCTCAGCAGCCTGGCCCTAGCCCGAAGTGCCCAGTTCCTATACCCGGCA
GCC
CAGCTGCAGCACCTCTGGAGGCTCCTGCTCCTCAACCAGTTCCATGATGTGGTGACTGGAAGCTGCA
TT
CAGCTGGTGGCAGAAGATGCCATGAACTACTATGAAGACATCCGTTCTCATGGCAACCCACTGCTCAG
T
GCTGCAGCCGCAGCCTTGTGTGCCGGGGAGCCAGGTCCCAAGGGCCTCCTCATTATCAACACACTGCCC
TGG
AAGCGCACTGAAGTGTTGGCACTGCCCAAGCCTTGTGGGGCTCACAGCCTAGCCCTGGTGACAGTGC
CA
AGTATTGGCTACGCTCCTGCTCCCACCCCTACTTCACTGCAGCCCCTCCTCCCCCAGCAGCCTGTGTT
T
GTGATGCAGGAGACTGACGGTTCTGTGACTTTGGACAACGGCATCATCCGGGTGAGACTGGATCCAACT
GGC
TGTCTTACCTCCCTGGTCCTGGTGGCTTCTGGCAGGGAAGCCATTGCTGAGGGAGCCCTGGGGAACC
AG
TTTGTGTTGTTTGATGATGTGCCATTGTACTGGGATGCATGGGATGTCATGGATTACCATCTAGAGAC
A
CGGAAGCCTGTGCTGGGCCAGGCAGGGACCCTGGCAGTGGGCACTGAAGGTGGCCTCCGGGGCAGTGCC
TGG
TTCCTGCTCCAGATCAGCCCCAACAGCCGGCTCAGCCAGGAGGTTGTGCTAGATGTTGGCTGCCCCT
AT
GTCCGCTTCCACACTGAGGTGCACTGGCACGAGGCCCACAAGTTCCTGAAGGTGGAGTTCCCTGCTAG
A
ATACGGAGCCCCCAGGCTACCTATGAGATCCAGTTTGGGCACCTCCAGAGGCCGACGCACAACAACACC
TCT
TGGGACTGGGCTCGCTACGAGGTGTGGGCTCACCGCTGGATAGATCTGTCCGAGTGTGACTTTGGGC
TG
GCCCTGCTCAACAACTGCAAGTATGGAGCATCAGTACGAGGCAACGTCCTCAGCCTCTCACTGTTGCG
T
GCACCCAAGGCTCCAGACGCTACTGCTGACATGGGGCGCCATGAATTCACTTACGCTTTGATGCCACAC
AAG
GGCTCCTTCCAAGAAGCTGGTGTCATCCATGCTGCCTACAACCTCAACTTTCCCCTGCTGGCACTGC
CG
GCTCCAGGCCCGGCCCCTGACACCACCTGGAGTGCCTTTTCTGTGTCTTCACCAGCAGTAGTGCTGGA
G
ACCATCAAGCAGGCTGAGAGGTGCCATCAGCACCGCACACTGGTTCTAAGGCTGTACGAGGCTCATGGC
AGC
CATGTGGACTGCTGGCTGCACACGTCGTTGCCTGTTCAGGAGGCCACCCTTTGTGACCTCCTGGAGC
AG
CGAGACCCCACTGGTCACCTTTCCCTCCAGGACAACCGTCTGAAGCTCACTTTTTCTCCCTTCCAAGT
G
AGATCCCTATTGCTTGTGCTTCAGTCTCCACCAAACTGA


Translation (1039 aa):
MAAAPFLKHWRTTFERVEKFVSPIYFTDCNLRGRLFGDSCSVTLSSFLTPERLPYEKAVQQNFSPAQVGD
S
FGP
TWWTCWFRVELVIPEVWVGQEVHLCWESDGESLVWRDGEPVQGLTKEGEKTSYVLSERLRASDPRS
L
TLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSQAKLAVFHRDVHSLLVDLELLLGVAK
GLGEDSQRSFQ
A
LHTANQMVNICDPAQPETYPAAKALASKFFGQHGGESQHTIHAMGHCHIDT
AWLWPFKETVRKCARSWS
T
AVTLMEQNTDFIFACSQ
AQQLEWVKSQYPGLHARLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFL
Q
GQNFFLQEFGKMCSE
FWLPDTFGYSAQLPQIMQGCGIKRFLTQKLSWNLVNSFPHHTFFWEGLDGSRVL
V
HFPPGDSYGMQGSVEE
VLKTVTNNRDKGRTNHSGFLFGFGDGGGGPTQTMLDRLKRLSNTDGLPRVQLS
S
PGQLFTALERDSGQLCTWVGELFLELHNGTYTTHAQ
LKKGNRECEQILHDVEVLSSLALARSAQFLYPA
A
QLQHLW
RLLLLNQFHDVVTGSCIQLVAEDAMNYYEDIRSHGNPLLSAAAAALCAGEPGPKGLLIINTLP
W
KRTEVLALPKPCGAHSL
ALVTVPSIGYAPAPTPTSLQPLLPQQPVFVMQETDGSVTLDNGIIRVRLDPT
G
CLTSLVLVASG
REAIAEGALGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSA
W
FLLQISPNSRLSQEVVLDVGCPYVRFHTE
VHWHEAHKFLKVEFPARIRSPQATYEIQFGHLQRPTHNNT
S
WDWARYE
VWAHRWIDLSECDFGLALLNNCKYGASVRGNVLSLSLLRAPKAPDATADMGRHEFTYALMPH
K
GSFQEAGVIHAAYNLNFPLLALPAPGPAPDTTWSAFSVSSPAVVLETIKQAERCHQHRTLVLRLYEAHG
S
HVDCWLHTSLPVQEAT
LCDLLEQRDPTGHLSLQDNRLKLTFSPFQVRSLLLVLQSPPN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser