NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40504.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40504.1 Public Mus musculus 8 Galns 23 108 98 CCDS HistoryNCBI Gene:50917Re-query CCDS DB by CCDS ID:40504.1Re-query CCDS DB by GeneID:50917See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40504.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000015171.10 ENSMUSP00000015171.9 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000015171.10Link to Ensembl Protein Viewer:ENSMUSP00000015171.9Re-query CCDS DB by Nucleotide ID:ENSMUST00000015171Re-query CCDS DB by Protein ID:ENSMUSP00000015171
Original member Current member NCBI NM_016722.4 NP_057931.3 Accepted alive Link to Nucleotide Sequence:NM_016722.4Link to Protein Sequence:NP_057931.3Re-query CCDS DB by Nucleotide ID:NM_016722Re-query CCDS DB by Protein ID:NP_057931Link to BLAST:NP_057931.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057931.3 520 Q571E4 520 100% 0 0

Chromosomal Locations for CCDS 40504.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 122579111 122579197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122581051 122581168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122584912 122585033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122591438 122591540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122592201 122592337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122595766 122595869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122598520 122598659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122599039 122599166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122599273 122599339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122600475 122600618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122603378 122603480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122604139 122604213 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122605140 122605263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 122611228 122611338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1563 nt):
ATGGCGGCCTGTACCGCAGCCCAGCAGCTGCTGCTGGTACTGAGTGCCCTAGGACTCTTGGCCGCAGGTG
CT
CCGCAGCCCCCCAACATCGTGCTACTGCTCATGGACGATATGGGGTGGGGTGACTTGGGTGTGAATGG
A
GAACCTTCCAGAGAGACCCCAAATTTAGACCGGATGGCTGCAGAAGGGATGCTTTTCCCAAGCTTCTAT
TCT
GCCAACCCTTTGTGCTCACCATCTAGGGCAGCCCTGCTCACAGGACGGCTGCCCATCCGCAATGGCT
TC
TACACAACCAACGCTCATGCAAGGAATGCTTACACACCTCAGGAGATCATGGGTGGGATCCCTAACTC
A
GAGCACCTCCTGCCCGAGCTCCTGAAGAAGGCAGGCTATACCAACAAGATCGTGGGCAAGTGGCATCTG
GGT
CATAGGCCCCAGTTCCACCCCCTGAAGCATGGATTTGACGAGTGGTTTGGATCTCCCAACTGTCACT
TT
GGACCGTATGACAACAAGGCCAAGCCCAACATCCCTGTGTACAGGGACTGGGAGATGGTCGGCAGATT
T
TATGAAGAGTTCCCAATTAACCGGAAGACTGGGGAAGCTAACCTCACCCAGCTCTACACACAAGAAGCG
CTG
GACTTCATCCAGACACAACATGCAAGGCAGAGCCCCTTCTTCCTCTACTGGGCCATCGACGCCACTC
AT
GCACCAGTTTACGCCTCAAGACAGTTCTTGGGCACCAGCCTTCGAGGGCGGTATGGCGATGCTGTTCG
G
GAAATAGATGACAGTGTTGGGAAGATCTTGAGCCTTCTGCAGAACTTGGGCATCAGTAAGAACACATTT
GTC
TTCTTCACGTCTGATAATGGTGCGGCCCTCATTTCTGCTCCCAACGAAGGTGGCAGCAACGGTCCCT
TC
CTGTGTGGGAAGCAGACGACATTTGAAGGCGGGATGAGGGAGCCTGCGATCGCATGGTGGCCAGGACA
C
ATTGCTGCAGGCCAGGTCAGCCACCAGCTGGGAAGCATCATGGATCTCTTCACCACCAGCCTGTCCCTT
GCA
GGCCTGAAGCCCCCCAGTGACAGGGTGATTGATGGACTTGACCTCCTCCCCACCATGCTCAAGGGCC
AG
ATGATGGACAGGCCCATATTTTATTACCGTGGCAACACTCTGATGGCTGTCACTCTTGGCCAGTACAA
A
GCACACCTCTGGACTTGGACCAACTCCTGGGAGGAGTTCACACAGGGCACTGACTTCTGCCCCGGGCAG
AAC
GTCTCAGGAGTTACAACCCACACCCAGGAAGAACACACGGAGCTACCCCTGATCTTCCACCTGGGAC
GG
GACCCAGGGGAGAGATTCCCACTCAGCTTCCACAGTGACGAATACCAGGACGCCCTCAGCAGGACCAC
C
CAGGTTGTCCAGGAGCACCAAAAGTCCTTGGTCCCCGGACAGCCCCAGCTCAATGTGTGTAACCAGGCT
GTC
ATGAATTGGGCACCCCCAGGCTGTGAAAAACTAGGGAAGTGTCTGACACCTCCTGAGTCTGTCCCTG
AG
AAGTGTTTCTGGGCCCATTAG


Translation (520 aa):
MAACTAAQQLLLVLSALGLLAAGAPQPPNIVLLLMDDMGWGDLGVNGEPSRETPNLDRMAAEGMLFPSFY
S
ANPLCSP
SRAALLTGRLPIRNGFYTTNAHARNAYTPQEIMGGIPNSEHLLPELLKKAGYTNKIVGKWHL
G
HRPQFHPLKHGFDEWFGSPNCHFGPYDNKAKPNIPVYRDWEMVG
RFYEEFPINRKTGEANLTQLYTQEA
L
DFIQTQHARQSPFFLYWAIDATHAPVYASRQFLGTSLRG
RYGDAVREIDDSVGKILSLLQNLGISKNTF
V
FFTSDNGAALISAPNE
GGSNGPFLCGKQTTFEGGMREPAIAWWPGHIAAGQVSHQLGSIMDLFTTSLSL
A
GLKPPSDRVIDGLDLLPTMLKGQMMD
RPIFYYRGNTLMAVTLGQYKAHLWTWTNSWEEFTQGTDFCPGQ
N
VSGVTTHTQEEHTELPLIFHLGRDPGERFPL
SFHSDEYQDALSRTTQVVQEHQKSLVPGQPQLNVCNQA
V
M
NWAPPGCEKLGKCLTPPESVPEKCFWAH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser