NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40476.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40476.1 Public Mus musculus 8 Hydin 21 106 86 CCDS HistoryNCBI Gene:244653Re-query CCDS DB by CCDS ID:40476.1Re-query CCDS DB by GeneID:244653See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40476.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000043141 ENSMUSP00000046204 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000043141Link to Ensembl Protein Viewer:ENSMUSP00000046204Re-query CCDS DB by Nucleotide ID:ENSMUST00000043141Re-query CCDS DB by Protein ID:ENSMUSP00000046204
Original member Current member EBI,WTSI OTTMUST00000151035 OTTMUSP00000078328 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000151035Link to Vega Protein Viewer:OTTMUSP00000078328Re-query CCDS DB by Nucleotide ID:OTTMUST00000151035Re-query CCDS DB by Protein ID:OTTMUSP00000078328
Original member Current member NCBI NM_172916.2 NP_766504.3 Accepted alive Link to Nucleotide Sequence:NM_172916.2Link to Protein Sequence:NP_766504.3Re-query CCDS DB by Nucleotide ID:NM_172916Re-query CCDS DB by Protein ID:NP_766504Link to BLAST:NP_766504.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766504.3 5154 Q80W93-1 5154 100% 0 0

Chromosomal Locations for CCDS 40476.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 110267336 110267450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110298075 110298232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110299925 110300050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110309078 110309197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110312151 110312285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110326352 110326551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110334692 110334816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110354953 110355154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110365378 110365561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110380558 110380657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110392281 110392399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110397945 110398168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110404287 110404354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110410443 110410678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110413213 110413313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110415704 110415839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110418368 110418532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110419724 110419876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110446354 110446592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110450220 110450496 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110451958 110452101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110456500 110456643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110462437 110462750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110485370 110485507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110486323 110486395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110489781 110489891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110490589 110490798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110494291 110494428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110500641 110500818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110502926 110503053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110505169 110505299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110505743 110505879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110506094 110506221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110506428 110506619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110506881 110507030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110508884 110509123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110510836 110510998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110512992 110513165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110514114 110514287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110514830 110515003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110519081 110519301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110523072 110523209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110525444 110525627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110527907 110528048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110531049 110531217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110532676 110533293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110535165 110535386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110538305 110538513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110538719 110538901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110539719 110539838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110541521 110541680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110541796 110541968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110549589 110549787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110551273 110551372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110555532 110555631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110556996 110557164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110557629 110557864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110561023 110561140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110563796 110564000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110564968 110565203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110566599 110566750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110566901 110567090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110569325 110569427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110569612 110569899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110571811 110571953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110574841 110575059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110578151 110578311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110579549 110579646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110580671 110580866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110581960 110582172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110582667 110582805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110583902 110584067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110586023 110586170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110587034 110587241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110587636 110587857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110589450 110589619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110592609 110592807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110593667 110593825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110595218 110595495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110597787 110598006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110598959 110599171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110600242 110600405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110601238 110601388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110603162 110603392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110607685 110607909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 110609575 110610057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (15465 nt):
ATGACCCTGAAGATCAAATGTGTGGCTAATTATATAAAGGAAAAAATCCCAAACGTGCTCTTCTTATGCG
AC
CCTGAAGCAAGACTGCAACAGTTAACCGCCTCTGTGCCTCTCTGTGAGCAAAGAAAATATTTCAAACA
G
ACAAATAAAAGGCTAGAGGAGTCCATGGGGGCCATGCATCGGAAGATGGCCAAAGTGATCTCAGGACTG
CAG
AGCAAAGTCTTACCACCCATGAGCCCGAAGGTGGTCACAGAGGAGGAAGTGAACCGGATGCTGACAC
CC
TCAGAGTTCCTGAAAGAGATGTCCCTCACCACGGAGCAGAAATTGGCAAGTACAAGAATTATATGTCG
A
CCGCAGATCACCGAACTCTTAGATATGGGAGAAACAACACATCAAAAGTTTTCCAGAGTTGACTTGGAT
CAG
GCCTTGTTCCAGCCCTTTCCGTCTGAAATCATATTCCAGAACTATTCTCCCTGTGAAGTCTATGAGG
TG
CCATTGGTTTTAAGGAACAACGACAAAATCCCACGGATGGTAAAAGTTGTTGAAGAAAGCTCACCTTA
C
TTTAAAATCATCAGCCCCAAAGACATCGGCCACAAGGTAGCCCCTGGTGTGCCATCTGTATTCCGAATC
CTC
TTCACTCCAGAGGAGAACAAGGATTACGCCCACATGTTGACCTGCATCACCGAAAGAGAAAAGTTCA
TT
GTGCCGGTAAAAGCCAGAGGGGCTCGAGCCATCCTGGACTTTCCCGACGAGCTGAATTTCTCCACTTG
C
CCTGTGAAGTACAACACCCAGAAGGTTCTGCTGGTCCGAAACATTGGCAACAAAGACTCCATGTTCCAC
CTC
AAAACTCGCAGTCCATACTCAGTAGAGCCAACGGGCGGGATTCTCAACGTGGGCGAATCCATGCAAC
TG
GAAGTGGATTTTGAGCCACAGACTGTGGGCAGTCACGATGGAAAACTCATTGTGACTTATGACACAGG
T
GAAATGGTATTTGTATGTCTCTATGGAGTTGCCATAGATGTGAATATAAGACTGGACAAGAATTCGTTG
ATC
ATGGAGAAAACCTACATATCTCTGGCCAACCAGCGGTCTATAACCATTCACAATCGCACTAATATAA
TT
GCCCACTTCCAGTGGAAGGTGTTTGCCACCGAAGAAGAGGAAGACAAAGAAAAATACAAGATCTGTGA
T
GGCCTGAACAAGGAGGAAAAGCAGGAAACCAGCATGATCCTTGAAGACAGCGTCTTGGATCCCTCGCTC
CGA
GAGCGCCTCTCCATCATCTCCCGGACCTTCGAGAACCAGAGGAAACTGGTCCAAGGAGACAGCATGC
TC
TTTCTGGACCACGTTTTCACGATCGAGCCCCCGGAAGGTGATGTCTGGCCCAACTCATCCGCTGAAAT
C
ACTGTGTACTTTAACCCGCTAGAGGCCAAGCTCTACCAGCAGACAGTTTACTGTGACATTTCAGGCCGA
GAG
ATCCGCTTGCCCCTCCGAATCAGAGGAGAAGGAATGGGGCCCAAGCTTCACTTCAACTTCGAATTAC
TG
GACATTGGCAAAGTTTTCATTGGATCTGCTCACTGTTACGAGGCAATCCTGTCCAACAAGGGCAGCAT
C
GATGCCCTCTTTAACGTCATCCCCCCAACTTCAGCCTTGGGGGCCTGCTTTGTCTTCAATCCTAAAGAA
GGC
ATCATTGAACCGAGTGGGGTCCAAGCTGTCCAGATCTCCTTCAGTTCTACCATCCTGGGGTACTTCG
AA
GAAGAGTTCCTGATTGATGTCAACGGGTCCCCTGAGCCCGTGAAAATGACCATTAGAGGCTGTGTAAT
T
GGACCTACATTCCATTTTAATGTCCCTGCACTGAACTTTGGGAATGTTTCCTATGGATTTCCCCATACC
TTG
ATGTGTTCCCTCAATAATACATCTTTGGTCCCCATGACCTTCAAACTGCGTGTCCGCGGCGATGGCG
AA
GGCATGAGTAGCATCCCAAGTTACTCTCAGGAGTCAGACAGCAAGCAATGGTCCGGGATTAATACAGA
A
ATGCCTACCACAAAACCCAAAGAATTCACCATCTCTCCCAACAGTGGCACCATCCGTGCCCAGGGCTTT
ACT
GCCATCAAGGTGACCTTGTGTTCCAACACCGTGCAGAAATACGAGCTGGCGCTGGTGGTAGACGTGG
AG
GGTATCGGAGAAGAAGTGCTGGCACTCTTAATTACAGCCAGGTGTGTGGTCCCCAAGCTCCAGTTGGT
G
ACTACAGAGGTGGACTTTGGGCGCTGCTTCCTGAAGTACCCATATGAGAAGACCATCCAGCTTGTCAAT
CAT
GATGACCTTCCTGGATGCTATAAGGTCCTGCCTCAGCTGTATGAGAATTCACCCCCTGTGCTGCTCT
CC
AGCCCCTCCCCCTGTGGGGTCATCTCCCCCCACAGCACTGTGAGCATACCACTAGCCTTGGAGACACA
G
GTCATTGGCGCACATCGATCCATAGTTTACATCTCCGTCTTTGGGAGCCAGGAAGCCCCTCTGGCATGT
AAC
ATACAGAGTATTGGAGAAGGCCCCGTGATCTTCATACATCCCACTCAAATCGACTTTGGCAATATCT
AC
GTCCTGAAGGACACCTCCAGAATTCTCCAGCTCTCTAACCAGTCCTTCATCCCTGCAGTATTTCGGGT
T
CGCATGGCAAACAAGAAATCCCTTTGGACGGTTAAACCCAGTGAGGGTGCAGTTCCTGCAGAAGATGAC
ATC
CCACTGACACTGACTGCCAACCTGGACGACATAGTGACGTTCAAAGACACGGTCATCCTGGAGATTA
AG
CATAGTAACACCTATCGGATCCCCATCCAGGCCACCGGGATTGGTTCTACCATTGTTTCCGACAAACC
A
TTTGCTCCAGAACTCAACTTGGGAGCGCATTTTAGCCTGGATACCCACTATTACCGCTTCAAGCTGACC
AAC
AAAGGACGCCGAGTCCAGCAACTGTTCTGGATGAATGATGACTTCCGCCCCAAGGAAAAGCAGAGCA
AG
AAGGAACCGGGGAAAAAGGGCTCTACTTCCAGTAGCCGTCGCCAGTCCAAGGCCTCCCAGGAACCCAC
A
GATAACGGGAACCCCGTGTTCCAACTTTACCCCGTCAGGATGGAGTTGTACCCGGGACAGACGATTGAC
GTG
ATCCTTGAAGGCTATTCCGCCACGCCCAAGAAAGTCAAAGAGAAGCTGGTGTGCCAGGCCATCGTCG
GA
ACCCAGAAGGGCAAAAGCTTGCTGATGTCCGTGAACATCATCTGCGAGTTTATAGCTCCAATCATCCA
G
CTCTCCGCCAAGCAGCTACTATATCGACTGGAAAAGAAGCCGAACTCTAACCTGGAGTCTGATTACCAG
TCC
TTGGTGATAAAGAACATCACCACCCTGCCTGTGAACATGCTGCTCTCTACAACCAGACCCTTCTTCA
TA
TGTGAGACTGATAAGTCCCTACTGCCTGCAACCCCTAAGCCTATAAAACTGGAGGTTGATGAGGAGAA
A
CACCTCCTGATCAAGTTTGATCCCTCCTACAGAAACGACCTGAACAACTGGGTGGCAGAAGAGGTTCTG
TCA
ATTAAGTATCTAGAACACCCTCAGGTGGACAACCTGGGCTTGCGTGCTGAAGTGCATTACCCCAACC
TC
AGCTTTGAGGTGATGGACATAGATTTCGGCTGCATCCTGAACGATACTGAGGTCATTCGCTACATCAT
G
ATCACCAACTGCAGCCCCTTGGTTGTGAAATTCCGCTGGTTCTTCTTGGTGGATGAGGAGGAAAATCAG
ATC
AGGTTTGCACCATGTATGAAGCCCTACAGCGCCTTCTTGTCCCAGATGGAGTCCATCGCGGCCACCT
CG
GTCACCGCCAGCTCTCTGGCAGCCCCACACACTGTAGAGTATACGGAGATGGACTTCAGTGATTCCAT
C
AAGACGATCCTTATGGATGACGAAGCTGGACCCGAAGAAATCAAAAAGCCCGCGACATCCACCATGGTC
TCA
GAAGCGATAAAATACAGCTCCGCGGGAACGGAAAGAAGCCAGAGCCAGCCGGACTACCCAGAATGCA
TG
TGGATCTATGAACAGGATGAGATGCTGTCTATTGGAATAGAAGAAGTGTTTGACATTCTGCCTCTCTA
C
GGAGTTCTGCGGCCCTACAGCAGCCATCAGATATCGTTTACCTTCTATGGACACTGTGACATCATCGCC
CGG
GCCAAAGCTCTGTGTGAGGTGGAAGGAGGGCCCACCTATGAAGTACTACTGAAGGGGGAGGCGTCCC
TG
GTCAACTACTCCTTTGACACGAAGGACATTAACTATGGATTGCAGCTGTTTGACCATGTCACAGAACG
T
GAAATCACACTGAAAAACACTGGGAAAGTTGGCTTTGAGTTCAATGTACTGTCTAACTACCGGTCTTCA
CAA
AGGAACCTTCTCCCTGGAGTACCACTTATCCTGCCTCTGTCGGGTTTTATCCAGTCGAATAAGGAGC
AG
GTATTGAAAGTTTACTACTTGCCTGGAATACCTGAGGTCTTTCAAAGAAACTTCCAGATACAGATCGC
C
CACCTGGTCCCAGAAAACATCACCCTGTACGGAGAGGGCATCTTTCCACGAATCAGCCTTGACCTACAC
AGG
AACCTCCAAGGCAATGAAAAGTATGAACACTTCTTGGAACAAGCAAAGAAAAACGTAGAAAAAGAGT
AC
ACTAAATATGAGGCTGTCGATCAATATGAGGTGATGGCTGAGGAACTCCCAGAGGAGGAGACCGCTGA
A
ATAAGTGCTCATGTCCAGATGGAAGTAGAGCGACTCATAGTCCAAGACTATGCCCTGGAACACCAGAGA
AGC
ATCTCCAATAACACCGAGGACATCTACTTCAGTCAGCGGAGTTGCCGAAAACTCACCAAAGTCCAGC
TG
CCAGAGTACATCCTGGACTTCGGCTACATTGTACTTGGTGACGTCAGAACCCACATCGTCAAGATCAC
C
AACACCAGCCACTTCCCTGTGTCCTTCCACGCAGAGAAACAGGTCCTTCACGAAACAGGCTTCAGCACT
GAG
CTAGACCGTGTAAAGAACCTGCCTTACTATGAGACAGAAACATTTGAAGTGAGGTGTGACCCACAAG
GG
GCTAATCTCCCTGTGGGGAACAAAGAAGTCATTCTCCCCATCAAGGTGTACGGAGGGCCAACCATTCA
C
CTCTGCCTCCAGGCCACGGTGATCATCCCAAGTATGACCCTGTCGTGCAACAAAATAGAGTTTGCCACG
ATT
CAGTGTGGGCAGTGCATGGTGGAAACGATCCAGCTTTCCAACCATCTCCAAGTCCCTTGTGAATGGT
TC
GTCCACACCCCAAAGTCTACTAACAAGCTGGACAAACACATGCCAAAGTATTTACGGCGGAAGCTGCA
A
GCCGAGATGATTCCCAAGTCTCGGATCTTTGAGATCCAACCCACTTCTGGCATCTTGGATCCCGGCGAG
AGG
GCTAATGTGCAAGTGAAATTCATGCCCAAGGAAGAGAAACTTTACAGCCAGTCTCTGTTGTTCCAAA
TT
GGCCAGAGCTCTCAGAAGCTGACACTTCTGGCCCAGGGTCAAGGCCTGGAGCCACGCCTGGAGTTCAG
C
CCTTCCGTTCTGGAACTGGGGCCCCTCCTGCCTTTTGCATCAGGAGATGAGGCCGAGGTGATTGTGAGG
AAC
CCCTGCAACTTCCCCATTGAGTTTTACTCCCTAGAATTTGACCAGCAGTATCTCTTAGAAGAGAAGA
TG
TTGCGACAGCTGAAGGGCTACGACTCCTACAACACCCTGCTGCTGCCTCCCCGGAACCCAGGGGAGAA
G
CTGCCACCAGAAGTCTATGATTACTTTAAGGAGATGAAGAAATCGAAAGAGGAGCACATGAAGGCCAAG
TAC
ATGGAGAACCTGGAGAACGAAGAGGAAGAAATGAATACGTCTGACCAAGGAACCACCAGCACAAAGA
GG
ACATCAATTAGCCGAGGGATCTCAGTCACATCCAACCTGGAAGAGCGGCATCTCACAATTGAAGCCAA
A
AACTACCTAGATGAGGATGACTATGAAGAAAGCCTGGAAAAACTAACATTTCAAACCGACAAGATGCAG
AGC
ACAGACAGCCACTCCGTAGAGGAGGTTGGAGAGGTGGAGAGCAATCCAGTGAGCAAGGCAATCGCAC
GC
CACCTGGGCATCGACATTTCTGCAGAAGGCCGCCTGGCCAAGAACCGGAAGGGCATCGCCATTATCGT
C
CACGGGACGCCCTTGTCAGGAAAGACAGCCAATGCCATCAGCATGGCCAAGTTCTACAACGCAGCCTGC
CTG
AACATTGACTCCATCGTCTTAGAAGCCCTATCAGACACCAACAACATCCTAGGGATTCGGGCCCGGG
AG
CTGTGCATCAGAGCTGCCATAGAGCAGTCCATGAGGGAAGCAGAGGAGTCAGCTCATGAGTCTTCAAT
G
ACCCAAAATACTGTGGTACCAGCACGACTAAGCACTGAGAACTTGGGCAGGTTTACCTCAGAGCTCACT
CTA
ATAACCCAGGAATACAAAGTTCCGAAGACCGTGCGCGGGAGTGTGATGCTCCCCAAAGGCAAGGCGG
AC
AGCCACTTTACTGGGTCTCAGAAGCAGCATCACCAGCACCAATCCGAAACACCGCAGGTACAGATCTC
C
TCTAGCCCTCTCCTCCCCGGCCCCACCCATCGGCGGCTCAGCGTCAGCGCCAGTATTGGCGGGGAGACC
GGG
CTGATGAGCTGCGTGCTCCCAGATGACCTCCTCATTCAGATCCTGGCTGAGCGGATACAGCTGAGCA
AC
TGTTTCAGAGGCGTGGTGTTCGACGGCCTGGACACGCTCTTTGCACGGAATGCGCCCTCTGCCCTCCA
C
TGCCTGCTAAAGGCCATCGGCAGCCGGGAGCACATCTATGTCATCAACATGTCTCAGGATTATGTCGTC
ATG
AAAGCCCAGGAGAAGGCTAAAAAGGAGCAAGAAGAGAACAAACGCAAGGAAGCCCTGGCAAAGGAGA
AG
GAGCGTCTCCAGACACTGGACGAGGACGAGTATGACGCCCTAACAGCAGAAGAGAAAGTTGCATTTGA
C
CGTGATGTTCGGCAGGCACTCCGGGAGAGAAAGAAGAGGGAGCTGGAAAGACTTGCCAAGGAGATGCAG
GAG
AAGAAGCTGCAGCAGGAGCTGGAGAGGCAGAAGGAAGAGGATGAGCTAAAACGGAAGGTCAAAAGGC
CC
AAAGCAGGCCCTGCGGCAAAGGAGGAGCCACCCCTAAAGAAAGCACAAGGCGCCACAAACAAGCAGCT
T
GCTGCAGTTGCCAAGATAGAATTAAAGATGGAATCAATAGAAAGGAAAGTTTCTGTCAGAGAGCACGCA
ACA
CTTGAAGAAACCACCAGGAAGAAGAAAGCCATGACCGAATACCCACTCTTAATTCCAATTTCCCAAG
AA
CAAGAGGACAGCGAAGGAGACTTCCTGAAGGACTCTGACAAGAACCTGGCACAAAAGTTTAAAATCTA
C
GACATGTGTCTGAAGGATGTTCAAAACATCCTCATGTATTGGGACCGCAAGCAAGGGATGATGGTACCT
CAT
ACAGGCACGGACGAGATGTCACATGAGGCTGACGACCAGCGCCAGGCGCCTTCAGGGGGCGGGGGTC
GC
AAGGGCCGCAAGGACCGGGAGAGGGAGCGCTTGGAGAAAGAGAGGGCTGAGAAGGAGCGGCTGGAAAG
G
GAGAAGGCTGAGAGGGAGCGGCTGGAGAAGCTGAAGGCCCTGGAGGAGCGGAGCGACGTGGAAGGGGAA
GGG
GAAGAGGAGCATGAAGGAAAGAAGGATCTCGGGGTGCCCTTTATCAACATCCAGTCTCCAGACTTCG
AA
GGTGTAAGCTGGAAGCAAGCTCTGGAGAGTGACAAGCTTCCCAAAGGAGACCAGATCCTGGACATCCT
A
GGCCTGGGGTCCTCAGGACCACCCATCCCTCCTCCCGTCTTGTTCTCCATCATCTCTTACCCAGCAAAG
CGG
CAGTCTTTGGTCGCCACGGAGATCCTAAAGCACTTTGTGTTTGTGATTCCACCAAACGATGACATCC
CC
CTGATGGACGAGAAAAAAGACCCGGAAGGAGATTCAGACATCTTCCTCAACACCATCATAACCAAGGC
T
CAAGAGGAACAACCCTCTCCACCTAAGGGAAGCAAACAGAAATTGAAAGACAAACCAGAGCAAGTGCGG
GAA
ACTCAGAAGGAAAAACGACGCACTTACTCCAGCAGGAAAGGCCTCCCTGGGGGAACATCGGGGAGCA
TT
GTTCCGATGTCTGACATAGACCAGAACAGCTTTGATGGAGAACACTCCCAGGAGAAGTTCATCAGGCT
G
AATCACTTCCGGTGGATTGTGCCTCCAAACGGAGAGGTAACCTTGAGAGTGCACTTCTCCTCTCTAGAT
GTT
GGCAACTATGACCAGACGTTTAATTTCGAGCTCCTTGGGACCCGCCGCCAATACCAGCTCTACTGCC
GC
GGAGTCTGCACCTACCCATACATCTGCAGAGACCCCAAAGTTGTGTTTTCTCAGAGGAAGAAAGACAT
G
AAGTTAAAAGAAGTTGTTGTTAAGAAGTATGTTGTGAGCATGGAGAAGTTTTACTTTGGGCCACTGCTT
TGT
GGAAAGTCAAGAGACAAGTATAAGTCATCCTTGTTCCCTGGCAACATGGAGACACTGACGATCCTGA
AT
GATTCTCCAATGGTGGTAGAGGCATACTTCTGTTTCCAGCATGACATAAAAGCAAGCACCTACTTTCT
A
GAGCCGGTCAACATGACTCTGAAACCCAATGAAAAGCAGGCACTAAACGTATGGGCCTACCCTACTGCA
GTT
GGTATCTTTGAAGACAGCATTGTCTGCTGCATCAAAGAGAACCCAGAGCCAGCCATCTTTAAGTTAA
GC
TGCCAAGGAATTCGCCCAGAAATTGAGGTGGAGCCCAGGCAGTTACATTTTGACCGACTCTTGCTTCA
T
AGGAAAGAAACCAAGATAGTAATTCTCCGCAATGTCACGCCTCTTCCTGTGGCCTGGCGGATCTCCAAC
CTG
GAACACCTAGGGGAGGACTTTACTGTGTCCATGATGCAGGGCACCATGCTACCCAAGGGAGAGTATG
GG
CTGCAAGTGCACTTCCAGCCCTCCAAACCTGTCAACATCAAGAAGGCCATTCGGATTGAGGTTTTGGA
C
GCAGAAAATCTTGTTGGTGTCGTTCAGATCGAAAACATCTTGATCTTTGCAGAATCGTATGATATCGCT
CTG
GACATCACCTTCCCTAAAGGAGCTGAAGGAGGTCTGGATTTTGGGACTTTGAGGGTCATGGAGGAGG
TA
AAGCAGACCCTTCAACTGAAAAACCGTGGAAAATATGAGATCATATTCAGCTTCACTGTGGACACCTT
A
GGGGTTTTGCCAACAAACTTAAGTTCCATGATCTCAGTCCAACCCAAGAGGGGGACACTGGCCTCAATA
GAT
AAGCCCACAACTGTCCAGGTGTTCTTCCGAGCAAGAAAGGAGGTGAAGATCGATTGCCAGCCCATCC
TG
CGCTGCCAGATTATTGAGCCAACTCTCCCAGAAGGTGAGATCATTGCCAGCATCCCTATTAAGTTTTC
G
GTGAATGCAGTATACTCCAAATTCACCATCAGCCCCTCCTCCATCATCAATTTTGGGGCTTTGATCTGC
GGT
ACCAGGAAAAGCATCACCTTCACCATAGAAAACCAAGGCATAATCGACTTCAAATATGCCCTCTACA
GG
CTGACAGGGGAGAGTCCAATTCTTCAAAAGAAGATAACCAGCCACATGAGGCATGGAAGAACCCGAGA
G
AGTGAAAGCTTCTACAAGCCTGGAGCAACTAAAATGGCCAAGTTCTCAGACACAGTCCAGAAAGACACG
AAC
ATAGCAAACCAGGCCCGCTTCACCCATGGCATGTTCACTGTATACCCAGGATTCGGCTCCATCCCTT
CT
GGAGGACAGCAGGTGATCACCATTGAGTGTTTTGCAGACCCTGTGGGGAGGTGTGAAGAGTTTCTGGC
C
ATCGATATCTCTGACCGAGACCCTAGAGAAAATCCTGCCGGCATCCCTTACACTCTGCTTGCTGAAGCA
TGT
CTGCCAGCCTTTGTGACCGACAACAACATCTTGATATTTGAGGAGCATCAGATCTGCACCAGCCCCA
AC
CTGTACCACATCCTACAGACCATACAGAGTGGGGGGCTGTTCGTGGAGGATGAGAACAAGTTCATCTT
C
TGCAATGTCCTGGTGGGTCATCAGGCCAAGGCTCGGTTCAAGATCAGCAACGTGGGCAAGATCTCCTGT
GAC
ATCAACATTGTCATCAAGCCCATCTCCAACAAGCCGGCCAACCGCATCACTGACACCTTTGACGTGG
AA
CCCAGCAAGATGTGCATCGGGAGCCGCTCACATGCCTTCGTCACAGTGCTGTTCACACCACAGACCAT
G
CAGACCTACCAGTGCATCTTCGAGGCCACTTTGGATGGCCTGCCCAGCAACATTGCCAGGAGCCGAGGT
CTT
GTGTTTGATATTGTTGGTGAGGGGACTCTCCCTCGAGTGACTGTCATCCGGCCAACTCTATATAACC
AA
CACGGAAACCCCTTGCTCCTGTTTAAGAGGCTTCTGCTTGGTCATTCGGAGAAACTGCCTCTCATCCT
T
AAGAATAACGGCACCATCCCCGCCCAGCTGCATGTGGACCTGCGGGACCAACTAGGAGTCTTCTCTCTG
AAA
GGGAGACCCACCACCTCCTACATCTACATCATGGAGGAAAATAAACCGAATGAAAAAGTCAAGAAAG
CC
CACACGGCCTCCCTGGTTGTTTCTCCTGGAGACACGGCTGAATTTGATGTCTTTTTCCACTCCAATAA
G
ATTGGGAGAATGACAGGCACCATCCACTTATCAGTGATCAACAACCAGTATGAGGAGACCATGATCCAC
CTG
GTTGGAGAAAGCTACGAGGATGACATCACCTTGGACAACATCCATGGACTGATCAGTTCCACCAGCC
AG
GAGAGCTCGGATAAGTCTGAAGTCATAGAGATCGCCGAGGAGAGCACCATGGAGGACTTGGTGACAGC
T
GCCCTGATGGAACACATCCAATTTGGGTACTGTCATATTGGAATCAGCTACAATGTGAGCTTCACCATC
ACC
AACCACAGCCAAGTGAATGTGATTCGCTTCGAGTGGCCCCTTTTAGCTACACTGTCCTTCTCCCCAC
AG
ATTGGGCATCTCCACCCTGGCTGTTCCAAGGACGTGGTGGTGACCTTGAAATCAGAATCACCCATCAC
C
CTGAAGAAGATGTGTGTCAAGTGCAAGCTTTCCAAGATCATGTTTCAGCTCCCTGTAGACCAGGTCCCT
GAC
TGGGATGACCGCATGCGCACAGTCAAGTGGGTGGATGCTCCCCGAAATACACCTCTGACCTTGAATA
CA
AAACGAAAGGTCATAGAGATGGACCCTGAGCCAGCCCACTCGGTGGTAGAAGAAAATTACCGAGAATT
G
CGGATCCAGTTCAGTGCCAATGTGGATTTTGCTTCATATCAGTGTGAAACAACTGAAGTGTTCTTTAAG
GAA
ACACTGGTTTACCAGACCCGAGTGTTTGAGTTTGACCTCGTTAACACAGGACAGGTGCTGTTAGAAT
TC
TGCTGGATCTCAGAAGAAGCCTCCAAGGCAGTCAGTTTTGCCATGCCTGAGCGTCAAGGTTCAAGTCA
A
AAAGAGCTAAGTCAGGGCTCAGGCAGCTCCCTGGACAGTGCCCTGGACCGCTGGACCGAAGCCTCGCCA
TCA
CCCTTCTCAGTGGAACCCCCCTCAGGCGTTGTGCCCGTAGGAAAGACTCAAAAGCTCAAAGTGAAGT
TC
TCGCCAATGGACATCGGAGAGTTCGAGAGCTCCTTGTACTGCCAAATTCCCAACCTCCCACTTGGAGA
A
CAAGGTCCTATTTTGATAACAAAAGGGCGAAGCGTCCTGCCGTTCTGCCACTTTGACCTGAAGGAGTCG
GAC
TACATCAGTGGTCATCGGCGCAACCCAGAGCTCCGAGGACCAGGCGCTGGGCCTCTCGAACCTAATA
CC
CGTGTGATTGAGTTCACCAGTGTGGGCATCGGTGGGAAGAATGTCCAGACCTTCACAATTCTGAACCC
G
ACCAACAGCACCTATTCTTTCTGCTGGACCTCTGAAGAGACGGAAAGTCTCCAGCACCCTCCGGCCTTT
GTG
TGTCTTACAGAAAAGGGTATCATCCACCCTGAGAAGAAAGCTGAGATTATATTCCAGTTCCTGCCGG
CT
CACCTGGACATCACGGAAGAGTTCTGGACTTTCTCTATCCCAGAGCATAATATCTCAGTCCCCTTCCT
G
CTGGTGGGCAAGACCACAGACCCCCTTATCTCTCTTGACAAGTCTCACCTCAATTTCAGCTCTCTCCTC
ATT
GGCAGAGAAGCCCGAGAGACAGTAAAGATCATCAACAAGGAGGAGCAAGGGTTCAATTTCGCCTTCC
AG
GACAACTCCCGCTATTCTGAAGGATTCAACAACAGCCTCATTGTATGCCCCATGGAAGGCTGGATCCC
G
CCACTGTCCAGGTTCCCAGTTGATATTTTCTTCACACCAAAGCAAGAAGGAGATGTGAACTTCAATTTG
ATC
TGCAATATAAAAAAGAAAGCTCACCCTCTGACACTCAACGTCAAGGCCGAGGGCTACACTATGAATG
CT
GAGGTCAAGTGCAGAGACAGGATGGGCACCACCATCCTCCTGACATCCACCCAGGTCAACACCATCAA
C
TTCTACGAGGTGGAGTTGAATGAATGTGTTCAGTGTGAATTCAGTTTCATCAACACGGGCAAGTTCAAC
TTC
AGCTACCAGGCAGAGCTCTCTGGACCAAAACTCCTGTTGCAATACTTGGACTTCACACCCACCGACA
GT
AGCGTAGACGTGGGTCAGTCTGAACCGGCCAACCTGTCATTCCAACCGTATCAGAAGTGTGTCTTGAA
G
GGCCTGGAACTCAAAATCAAGATCAGCCATGGCCCAACATTCGTATGCAACATCTTAGGCTGTGCTGTG
AGC
CCAGCTGTCCATTTCTCCTTCACCAGCCACAACTTTGGGACTTGCTTCATCTACCAAGCTGGGATGC
CT
CCATATAAGCAAATCCTCGTTGTCACCAACAAAGAAGAAACATCTATGAGCCTAGATTGTTTGTACAC
C
AACACCCCACACATCGAGGTGAACTTCAACGTGGACGTGATAAAGCCAGGGAAGACCCTGGAGATCCCA
ATC
ACCTTTTACCCTCGGGAAGCTATCAGCTACCGAGAACTCATCCCCTTTGAAATCAATGGACTCTCTC
AA
CAGACAGTGGAGATCAAAGGGAAGGGCACAGAAATGAAGCTTTTAGTCCTAGACCCAGCCAACAGGAT
C
GTGAAGTTAGGAGCTGTCCTGCCAGGACAGGTTGTGAGGAAAACAGTCTCCCTCGTCAACAACAGCCTT
GCC
CAGCTCACCTTTAATCACTCGGTCCTGTTCTCTATTCCAGAGCTCCAGGAAGCCAAGGTCATCACCT
TG
GAGCCCTTCCACACGATCACCATGAAGCCTAAAGAAGTCTGTAAACTAGAGATTACCTTTGCCCCCAA
G
AAGCGAGTCCCTCCTTTCTCTGAGGAAGTCTTCATGGAATGGATGGGGCTCCTGCGTCCTCTCTTCCTC
CTC
AGTGGCTGTTGTCAGGCCCTGGAGATTTCCCTGGACCAAGAGCATCTTCCCTTTGGCCCCGTTGTGT
AT
CAAACTCAAGCCACGCGGCGCATTCTCATAATGAACACAGGCGACGTGGGTGCAAGGTTTAAATGGGA
T
GTCAAGAAACTCAAGCCCCACTTCTCCATTAGCCCCGAAGAAGGCTACATCATCTCAGGCACAGAGGTG
GCT
CTAGAAGTAACATACCACCCCACTGAGATAGGGAAGGAGAGTCTCTATAAAAACATTCTCTGCTTCA
TC
CAAGGAGGAAATCCTCTGTGCCTCACCCTGTCTGGAACCTGTGTGGGACCACCTGTGGTAAAAGAGGT
G
GTGAATTTCAACTGCCAAGTGCGCTCCAGGCACACACAGACCATCCTGCTCTCAAACCGTTCCAACCAG
ACC
TGGAACCTGCACCCCATTTTTGAGGGTGAGCACTGGGAGGGGCCCGAGTTCATCACCTTGGAGGCCC
AT
CAGCAAAACAAGCCCTATGAGATCACCTACAAGCCCCGAACCATGAATCTGGAGAATCGCAAGCACCA
G
GGCACTCTCTTTTTCCCACTCCCCGATGGGACTGGCTGGCTATATGCCCTGCACGGGACTGCCGAACTC
CCC
AAAGCTGTTGCCAATATCTACCGTGAGGTTCCATGTAAGACTCCCTATACCGAGCTCCTGCCAATCA
GC
AACTGGCTGAACAAGCCCCAGAGATTCCGGGTCATTGTGGAAATATTGAAACCAGAGAAGACAGACCT
A
AGTGTCACCCTGAAGGGCCTTGATTACATTGATGTTCTGTCTGGCTCCAAGAAAGACTACAAGCTGAAC
TTC
TTTTCCTACAAGGAGGGACTGTACACTGCAAAGGTGATCTTCCGGAACGAGGTGACCAACGAGTTCT
TA
TACTATACTGTGAGCTTCAGGGTCACCCCTTCTGGCATTATAAAAACCATCCAGATGACAAGCCCAGT
C
CGCCAGAGTGTATCAGCCTCCATCAAGTTGGAGAACCCCCTGCCCTACTCAGTGACCTTTTCAACAGAA
TGC
AAGTTGAGTGACATTAGCCTGCCTTCCCAGTTCGCTGTGCCTCCAAACTCTGAGGGAACATTCTCAT
TT
GAATTCCAGCCCCTGAAAGCTGGAGAACTATGCGGGAGACTGACCTTGCACAACAGTGACTTGGGTTA
C
TACCAGTACGAGCTCGCTCTGAAGGCCTTGCCTGCACCTCCCGAGAAACCCGTCCACTTCCAGACCGTT
CTT
GGCAGCAGCCAGAGCATCTTAGCAAAGTTCACCAATTATACCCGGTTGAAGACAGAGTACTACTGCA
AG
ACTGACTGTTCTGACTTCCACACAGAAAAAGTTATTAACGCAGCCCCAGGAGCCCAGGGTGGCACTGA
A
GTCAGCGTGGAAGTCTTCTTTGAGCCCAGCCATCTGGGTGAGACTAAAGGCATCCTGTGCCTATCGTCA
CTC
ATAGGTGGGGAATATATCATCCCACTCTTTGGAATTGCTCTGCCCCCCAAACCCCAAGGTCCCTTCC
TA
ATCAGAGCCGGATACAACATCATCATCCCCTTCAAGAATGTCTTCTTGCATGCAACAAGCTTCTCCTT
C
ATTGTGGAGAACCCAGCCTTCAGCATCCGGGCTGCAGAGACCGTGCGGCCCAAGAAGATCAACAACATC
ACA
GTCTACTTTGAGGGGAACCCGTCGGGCAGTAAAACCCCGATCACCTCTAAGTTGATTGTCACCTGCC
CT
CAGTGTGAAGGCACCGAATCTGGAATCAAATGGGTTTATTATCTGAAGGGGATCACCCCTTAG


Translation (5154 aa):
MTLKIKCVANYIKEKIPNVLFLCDPEARLQQLTASVPLCEQRKYFKQTNKRLEESMGAMHRKMAKVISGL
Q
SKVLPPMSPKVVTEEEVNRM
LTPSEFLKEMSLTTEQKLASTRIICRPQITELLDMGETTHQKFSRVDLD
Q
ALFQPFPSEIIFQNYSPCEVYEVPLVLRNNDK
IPRMVKVVEESSPYFKIISPKDIGHKVAPGVPSVFRI
L
FTPEENK
DYAHMLTCITEREKFIVPVKARGARAILDFPDELNFSTCPVKYNTQKVLLVRNIGNKDSMFH
L
KTR
SPYSVEPTGGILNVGESMQLEVDFEPQTVGSHDGKLIVTYDTGEMVFVCLYGVAIDVNIRLDKNSL
I
MEKTYISLANQRSITIHNRTNIIAHFQWKVFATEEEEDKEKY
KICDGLNKEEKQETSMILEDSVLDPSL
R
ERLSIISRTFENQRKLVQGDSMLFLDHVFTIEPP
EGDVWPNSSAEITVYFNPLEAKLYQQTVYCDISGR
E
IRLPLRIRGEGMGPKLHFNFELLDIGKVFIGSAHCYE
AILSNKGSIDALFNVIPPTSALGACFVFNPKE
G
IIEPSGVQAVQISFSSTILGYFEEEFLIDVNGSPEPVKMTI
RGCVIGPTFHFNVPALNFGNVSYGFPHT
L
MCSLNNTSLVPMTFKLRVRGDGEGMSSIPSYSQESDSKQWSGINTEMPTTKPKEFTISPNSGTIRAQGF
T
AIK
VTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPKLQLVTTEVDFGRCFLKYPYEKTIQLVN
H
DDLPGCYKVLPQ
LYENSPPVLLSSPSPCGVISPHSTVSIPLALETQVIGAHRSIVYISVFGSQEAPLAC
N
IQSIGEGPVIFIHPTQIDFGNIYVLKDTSRILQLSNQSFIPAVFRVRM
ANKKSLWTVKPSEGAVPAEDD
I
PLTLTANLDDIVTFKDTVILEIKHSNTYRIPIQATGIGSTIVSDKPFAPELNLGAHF
SLDTHYYRFKLT
N
KGRRVQQLFWMNDDFRPKEKQSKKEPGKKGSTSSSRRQSKASQEPTDNGNPVFQLYPVRMELYPGQTID
V
ILEGYSATPK
KVKEKLVCQAIVGTQKGKSLLMSVNIICEFIAPIIQLSAKQLLYRLEKKPNSNLESDYQ
S
LVIKNITTLPVNMLLSTTRPFFICETDKSLLPATPK
PIKLEVDEEKHLLIKFDPSYRNDLNNWVAEEVL
S
IKYLEHPQVDNLGLRAEVHYPNLSFEVMDIDFGCILNDTEVIRYIMITNCSPLVVKFRWFFLVDEEENQ
I
RFAPCMKPYSAFLSQMESIAATSVTASSLAAPHTVEYTEMDFSDSIKTILMDDEAGPEEIKKPATSTMV
S
E
AIKYSSAGTERSQSQPDYPECMWIYEQDEMLSIGIEEVFDILPLYGVLRPYSSHQISFTFYGHCDIIA
R
AKALCEVEGGPTYEVLLKGEASLVNYSFDTKDINYGLQ
LFDHVTEREITLKNTGKVGFEFNVLSNYRSS
Q
RNLLPGVPLILPLS
GFIQSNKEQVLKVYYLPGIPEVFQRNFQIQIAHLVPENITLYGEGIFPRISLDLH
R
NLQ
GNEKYEHFLEQAKKNVEKEYTKYEAVDQYEVMAEELPEEETAEISAHVQMEVERLIVQDYALEHQR
S
ISNNTEDIYFSQRSCRKLT
KVQLPEYILDFGYIVLGDVRTHIVKITNTSHFPVSFHAEKQVLHETGFST
E
LDRVKNLPYYETETFEVRCDPQGANLPVGNKEVILPIK
VYGGPTIHLCLQATVIIPSMTLSCNKIEFAT
I
QCGQCMVETIQLSNHLQVPCEWFVH