NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4043.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4043.1 Public Homo sapiens 5 ARSB 22 109 92 CCDS HistoryNCBI Gene:411Re-query CCDS DB by CCDS ID:4043.1Re-query CCDS DB by GeneID:411See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4043.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000264914.9 ENSP00000264914.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264914.9Link to Ensembl Protein Viewer:ENSP00000264914.4Re-query CCDS DB by Nucleotide ID:ENST00000264914Re-query CCDS DB by Protein ID:ENSP00000264914
Original member NCBI NM_000046.4 NP_000037.2 Updated not alive Link to Nucleotide Sequence:NM_000046.4Link to Protein Sequence:NP_000037.2Re-query CCDS DB by Nucleotide ID:NM_000046Re-query CCDS DB by Protein ID:NP_000037
Current member NCBI NM_000046.5 NP_000037.2 Accepted alive Link to Nucleotide Sequence:NM_000046.5Link to Protein Sequence:NP_000037.2Re-query CCDS DB by Nucleotide ID:NM_000046Re-query CCDS DB by Protein ID:NP_000037Link to BLAST:NP_000037.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000037.2 533 P15848-1 533 100% 0 0

Chromosomal Locations for CCDS 4043.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 78780397 78780662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 78781852 78781974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 78839356 78839426 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 78885584 78885827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 78955295 78955502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 78964416 78964606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 78969006 78969192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 78984937 78985248 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1602 nt):
ATGGGTCCGCGCGGCGCGGCGAGCTTGCCCCGAGGCCCCGGACCTCGGCGGCTGCTCCTCCCCGTCGTCC
TC
CCGCTGCTGCTGCTGCTGTTGTTGGCGCCGCCGGGCTCGGGCGCCGGGGCCAGCCGGCCGCCCCACCT
G
GTCTTCTTGCTGGCAGACGACCTAGGCTGGAACGACGTCGGCTTCCACGGCTCCCGCATCCGCACGCCG
CAC
CTGGACGCGCTGGCGGCCGGCGGGGTGCTCCTGGACAACTACTACACGCAGCCGCTGTGCACGCCGT
CG
CGGAGCCAGCTGCTCACTGGCCGCTACCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTG
T
CAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACC
CAT
ATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATA
CC
TACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCT
G
AATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTAT
TCA
ACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTC
TC
TACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTT
T
ATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTC
ACT
GCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGC
AG
ACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCG
A
GGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATC
TCT
GACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCT
TC
GACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCC
G
AACTTCGTGGACTCTTCACCGTGTCCCAGGAACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCA
GAA
TATTCAGCCTTTAACACATCTGTCCATGCTGCAATTAGACATGGAAATTGGAAACTCCTCACGGGCT
AC
CCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTTTCTGAGATACCCTCATCAGACCC
A
CCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGAGAA
TAT
CCTCACATCGTCACAAAGCTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACT
TC
CCTGCACAGGACCCCCGCTGTGATCCCAAGGCCACTGGGGTGTGGGGCCCTTGGATGTAG


Translation (533 aa):
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP
H
LDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQ
IRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT
H
MVGKWHLGMYRKECLPTRRGFDTYF
GYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY
S
TNIFTKRAIALITNHPPEK
PLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV
T
AALKSSGLWNNTVFIFST
DNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI
S
DWLPTLVKLARGHTNGTKPLDGFDVWKTI
SEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP
E
YSAFNTSVHAAIRHGNWKLLTGYP
GCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSRE
Y
PHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser