NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4041.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4041.1 Public Homo sapiens 5 AP3B1 20 108 85 CCDS HistoryNCBI Gene:8546Re-query CCDS DB by CCDS ID:4041.1Re-query CCDS DB by GeneID:8546See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4041.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000255194 ENSP00000255194 Accepted alive Link to Ensembl Transcript Viewer:ENST00000255194Link to Ensembl Protein Viewer:ENSP00000255194Re-query CCDS DB by Nucleotide ID:ENST00000255194Re-query CCDS DB by Protein ID:ENSP00000255194
Original member Current member EBI,WTSI OTTHUMT00000225548 OTTHUMP00000133884 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000225548Link to Vega Protein Viewer:OTTHUMP00000133884Re-query CCDS DB by Nucleotide ID:OTTHUMT00000225548Re-query CCDS DB by Protein ID:OTTHUMP00000133884
Original member Current member NCBI NM_003664.4 NP_003655.3 Accepted alive Link to Nucleotide Sequence:NM_003664.4Link to Protein Sequence:NP_003655.3Re-query CCDS DB by Nucleotide ID:NM_003664Re-query CCDS DB by Protein ID:NP_003655Link to BLink:NP_003655.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003655.3 1094 O00203-1 1094 100% 0 0

Chromosomal Locations for CCDS 4041.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 78002902 78003055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78015410 78015548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78020692 78020789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78034361 78034445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78039043 78039274 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78089393 78089499 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78100953 78101025 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78110207 78110354 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78113752 78113923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78116126 78116234 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78128030 78128160 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78129121 78129307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78141143 78141319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78156258 78156367 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78162819 78162951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78165610 78165672 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78175626 78175697 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78175784 78175838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78177339 78177436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78181507 78181662 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78216055 78216237 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78225542 78225608 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78227372 78227532 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78228144 78228239 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78240862 78240936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78267520 78267595 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 78294452 78294579 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3285 nt):
ATGTCCAGCAATAGTTTTCCTTACAATGAGCAGTCCGGAGGAGGGGAGGCGACGGAGCTGGGTCAGGAGG
CG
ACCTCAACCATTTCCCCCTCGGGGGCCTTCGGCCTCTTTAGCAGCGATTTGAAGAAGAATGAAGATCT
A
AAGCAAATGTTAGAGAGCAACAAAGATTCTGCTAAACTGGATGCTATGAAGCGGATTGTTGGGATGATT
GCA
AAAGGGAAAAATGCATCTGAACTGTTTCCTGCTGTTGTGAAGAATGTGGCCAGTAAAAATATTGAGA
TC
AAGAAGTTGGTATATGTTTACCTGGTTCGATATGCTGAAGAACAGCAGGATCTTGCACTCCTGTCCAT
A
AGCACTTTTCAGCGAGCTCTGAAGGACCCAAACCAACTAATTCGTGCAAGCGCTTTGAGAGTTCTGTCA
AGT
ATTAGAGTGCCAATTATTGTACCTATCATGATGCTTGCTATTAAGGAAGCTTCTGCTGACTTATCAC
CA
TATGTTAGGAAGAATGCAGCCCATGCAATACAAAAATTATACAGCCTTGATCCAGAGCAGAAGGAAAT
G
TTAATTGAAGTAATTGAAAAACTTCTGAAAGATAAAAGCACATTGGTAGCTGGCAGTGTTGTGATGGCT
TTT
GAAGAAGTATGCCCGGACAGAATAGATCTGATTCATAAAAATTACCGCAAGCTATGTAACTTACTAG
TG
GATGTTGAAGAGTGGGGGCAGGTTGTCATAATCCACATGCTAACTCGATATGCTCGGACACAGTTTGT
C
AGCCCTTGGAAAGAGGGTGATGAATTAGAAGACAATGGAAAGAATTTCTACGAATCTGATGATGATCAG
AAG
GAAAAGACTGACAAAAAGAAGAAGCCGTATACTATGGATCCAGATCATAGACTCTTAATTAGAAATA
CA
AAGCCTTTGCTTCAGAGCAGGAATGCTGCGGTGGTTATGGCAGTTGCTCAGCTGTATTGGCACATATC
A
CCAAAATCTGAAGCTGGCATAATTTCTAAATCACTAGTGCGTTTACTTCGTAGCAATAGGGAGGTGCAG
TAT
ATTGTCCTACAAAATATAGCAACTATGTCAATTCAAAGAAAGGGGATGTTTGAACCTTATCTGAAGA
GT
TTCTATGTTAGGTCAACTGATCCAACTATGATCAAGACACTGAAGCTTGAAATTTTGACAAACTTGGC
A
AATGAAGCCAACATATCAACTCTTCTTCGAGAATTTCAGACCTATGTGAAAAGCCAGGATAAACAATTT
GCA
GCAGCCACTATTCAGACTATAGGCAGATGTGCAACCAACATCTTGGAAGTCACTGACACGTGCCTCA
AT
GGCTTGGTCTGTCTGCTGTCCAACAGGGATGAAATAGTTGTTGCTGAAAGTGTGGTTGTTATAAAGAA
A
TTACTGCAAATGCAACCTGCACAACATGGTGAAATTATTAAACATATGGCCAAACTCCTGGACAGTATC
ACT
GTTCCTGTTGCTAGAGCAAGTATTCTTTGGCTAATTGGAGAAAACTGTGAACGAGTTCCTAAAATTG
CC
CCTGATGTTTTGAGGAAGATGGCTAAAAGCTTCACTAGTGAAGATGATCTGGTAAAACTGCAGATATT
A
AATCTGGGAGCAAAATTGTATTTAACCAACTCCAAACAGACAAAATTGCTTACCCAGTACATATTAAAT
CTC
GGCAAGTATGATCAAAACTACGACATCAGAGACCGTACAAGATTTATTAGGCAGCTTATTGTTCCGA
AT
GTAAAGAGTGGAGCTTTAAGTAAATATGCCAAAAAAATATTCCTAGCACAAAAGCCTGCACCACTGCT
T
GAGTCTCCTTTTAAAGATAGAGATCATTTCCAGCTTGGCACCTTATCTCATACTCTCAACATTAAAGCT
ACT
GGGTACCTGGAATTATCTAATTGGCCAGAGGTGGCGCCCGACCCATCAGTTCGAAATGTAGAAGTAA
TA
GAGTTGGCAAAAGAATGGACCCCAGCAGGAAAAGCAAAGCAAGAGAATTCTGCTAAGAAGTTTTATTC
T
GAATCTGAGGAAGAGGAGGACTCTTCTGATAGTAGCAGTGACAGTGAGAGTGAATCTGGAAGTGAAAGT
GGA
GAACAAGGCGAAAGTGGGGAGGAAGGAGACAGCAATGAGGACAGCAGTGAGGACTCCTCCAGTGAGC
AG
GACAGTGAGAGTGGACGGGAGTCAGGCCTAGAAAACAAAAGAACAGCCAAGAGGAACTCAAAAGCCAA
A
GGAAAAAGTGATTCTGAAGATGGGGAGAAGGAAAATGAAAAATCTAAAACTTCAGATTCTTCAAATGAC
GAA
TCTAGTTCAATAGAAGACAGTTCTTCCGATTCTGAATCAGAGTCAGAACCTGAAAGTGAATCTGAAT
CC
AGAAGAGTCACTAAGGAGAAAGAAAAGAAAACAAAGCAAGATAGAACTCCTCTTACCAAAGATGTTTC
A
CTTCTAGATCTGGATGATTTTAACCCAGTATCCACTCCAGTTGCACTTCCCACACCAGCTCTTTCTCCA
AGT
TTGATGGCTGATCTTGAAGGTTTACACTTGTCAACTTCCTCTTCAGTCATCAGTGTCAGTACTCCTG
CA
TTTGTACCAACGAAAACTCACGTGCTGCTTCATCGAATGAGTGGAAAAGGACTAGCTGCCCATTATTT
C
TTTCCAAGACAGCCTTGCATTTTTGGTGATAAGATGGTCTCTATACAAATAACACTGAATAACACTACT
GAT
CGAAAGATAGAAAATATCCACATAGGGGAAAAAAAACTTCCTATAGGCATGAAAATGCATGTTTTTA
AT
CCAATAGACTCTCTTGAGCCTGAGGGATCCATTACAGTTTCAATGGGTATTGACTTTTGTGATTCTAC
T
CAGACTGCCAGTTTCCAGTTGTGTACCAAGGATGATTGCTTCAATGTTAATATTCAGCCACCTGTTGGA
GAA
CTGCTTTTACCTGTGGCCATGTCAGAGAAAGATTTTAAGAAAGAGCAAGGAGTGCTAACAGGAATGA
AT
GAAACTTCTGCTGTAATCATTGCTGCACCACAGAATTTCACTCCCTCTGTGATCTTTCAGAAGGTTGT
A
AATGTAGCCAATGTAGGTGCAGTCCCTTCTGGCCAGGATAATATACACAGGTTTGCAGCTAAAACTGTG
CAC
AGTGGGTCATTGATGCTAGTCACAGTGGAACTGAAGGAAGGCTCTACAGCCCAGCTTATCATAAACA
CT
GAGAAAACTGTGATTGGCTCTGTTCTGCTGCGGGAACTGAAGCCTGTCCTGTCTCAGGGGTAA


Translation (1094 aa):
MSSNSFPYNEQSGGGEATELGQEATSTISPSGAFGLFSSDLKKNEDLKQMLESNKDSAKLDAMKRIVGMI
A
KGKNASELFPAVVKNVASKNIE
IKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLS
S
IRVPIIVPIMMLAIKEASADLSPYVRKNAAHAIQKLY
SLDPEQKEMLIEVIEKLLKDKSTLVAGSVVMA
F
EEVCPDRIDLIHKNYRKLCNLLVDVEEWGQVVIIHMLTRYARTQFVSPWKE
GDELEDNGKNFYESDDDQ
K
EKTDKKKKPYTMDPDHRLLIRNTKPLLQSRNAA
VVMAVAQLYWHISPKSEAGIISKSLVRLLRSNREVQ
Y
IVLQNIATMSIQRK
GMFEPYLKSFYVRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVKSQDKQF
A
AATIQTIGRCATNILEVTDTCLNGLVCLLSNRD
EIVVAESVVVIKKLLQMQPAQHGEIIKHMAKLLDSI
T
VPVARASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLGAKLYLTNSKQTKLLTQYILN
L
GKYDQNYDIRDRTRFIRQLIVPNVKSGALSKYAKKIFLAQKPAPLLESPFK
DRDHFQLGTLSHTLNIKA
T
GYLELSNWPEVAPDPSVRNVEVIEL
AKEWTPAGKAKQENSAKKFYSESEEEEDSSDSSSDSESESGSES
G
EQGESGEEGDSNEDSSEDSSSEQDSESGRESGLENKRTAKRNSKAKGK
SDSEDGEKENEKSKTSDSSND
E
SSSIEDSSSDSESESEPESESESRRVTK
EKEKKTKQDRTPLTKDVSLLDLDDFNPVSTPVALPTPALSP
S
LMADLEGLHLSTSSSVIS
VSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTT
D
RKIENIHIGEKKLPIGMKMHVFNPI
DSLEPEGSITVSMGIDFCDSTQTASFQLCTKDDCFNVNIQPPVG
E
LLLPVAMSEKDFKKEQ
GVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTV
H
SGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser