NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS39643.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39643.2 Public Mus musculus 6 Ano2 21 106 86 CCDS HistoryNCBI Gene:243634Re-query CCDS DB by CCDS ID:39643.2Re-query CCDS DB by GeneID:243634See the combined annotation on chromosome 6 in Sequence Viewer

Public Note for CCDS 39643.1
The coding region has been updated to start at an alternate in-frame start codon that is supported by conservation and mouse transcript data.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 39643.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000160496 ENSMUSP00000125303 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160496Link to Ensembl Protein Viewer:ENSMUSP00000125303Re-query CCDS DB by Nucleotide ID:ENSMUST00000160496Re-query CCDS DB by Protein ID:ENSMUSP00000125303
Original member Current member EBI,WTSI OTTMUST00000083787 OTTMUSP00000045064 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000083787Link to Vega Protein Viewer:OTTMUSP00000045064Re-query CCDS DB by Nucleotide ID:OTTMUST00000083787Re-query CCDS DB by Protein ID:OTTMUSP00000045064
Original member Current member NCBI NM_153589.2 NP_705817.2 Accepted alive Link to Nucleotide Sequence:NM_153589.2Link to Protein Sequence:NP_705817.2Re-query CCDS DB by Nucleotide ID:NM_153589Re-query CCDS DB by Protein ID:NP_705817Link to BLAST:NP_705817.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_705817.2 1002 Q8CFW1 1002 100% 0 0

Chromosomal Locations for CCDS 39643.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 125690723 125690744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125710556 125710740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125712121 125712447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125775796 125775894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125790241 125790392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125793557 125793611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125796246 125796297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125806596 125806651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125807807 125807848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125815535 125815599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125863423 125863557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125867009 125867169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125872668 125872750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125880421 125880432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125880646 125880753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125955699 125955773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125963545 125963740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125980095 125980206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125982716 125982773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125982923 125983023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 125992819 125992964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 126013160 126013312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 126013680 126013732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 126015514 126015695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 126036848 126036953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 126039242 126039514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3009 nt):
ATGGCGGCCCCTGGGCTGCGAGACATCCCTCTGCTCCCTGGATCTCCACGTCGGCTGAGTTCTCGGACCG
TG
GCCAGAGGAAGCCAGGGCCCCAAACATGGGCAGCAGTACCTCAAAGTGCCAGGTCACCGGGCCCCAGG
T
CAGAGGGACAATTCCAGCCTACACCCTAGCCAGGTCTCCAGGAGAGAGAGTTCCCGAGACCGTTCTGTC
ATC
AATAACTACCTGGATGCCAATGAGCCCCCGTCCTCGGAAGCCCGTCTGAGCCGCATGCACTTTCACG
AC
AACCAGAGGAAAGTCGACTATGTACTTGCATACCACTACCGGAAACGAGGCGCACACCTGGGTCACGG
C
TCCCCTGGACACTCTCTGGCTGTTATCTCCAATGGGGAGACAGGCAAGGAGCGCCATGGCGGGGGCCCT
GGT
GATGTTGAACTTGGGCCACTGGATGCTCTGGAAGAGGAAAGGAGGGAGCAGCGAGATGAATTTGAGC
AC
AACCTGATGGCTGCTGGGCTGGAGCTGGAGAAGGACTTGGAGAGCAAAAGCCAGGGATCTGTCTTTGT
C
CGGATCCACGCCCCATGGCAGGTGCTGGCCAGGGAAGCAGAGTTCTTGAAGATCAAAGTCCCCACCAAG
AAA
ATGTACGAGATCAAAGCAGGAGGCAGCATCGCAAAGAAGTTCAGCGCCATTCTGCAGACGCTCAGTT
CA
CCCCTGCAGCCCAGAGTTCCTGAACACAGCAACAACAGGATGAAAAACCTCTCCTACCCATTCTCCAG
G
GAAAAAATGTACCTGTACAACATCCAGGAAAAGGACACCTTCTTTGACAATGCTACCCGGAGCCGCATT
GTA
CACGAGATTCTGAAGCGGACGGCCTGTTCTCGAGCCAACAACACGATGGGTATTAACTCTCTAATAG
CA
AACAATATCTACGAGGCTGCCTACCCGCTTCATGATGGTGAATATGACAGTCCAGGGGATGACATGAA
T
GACAGAAAGCTGCTGTATCAGGAATGGGCACGCTATGGAGTGTTTTACAAATTTCAACCCATTGACCTC
ATC
AGGAAGTATTTTGGAGAGAAAATTGGGCTATATTTTGCTTGGCTGGGGTTGTATACATCATTCCTGA
TC
CCATCTTCTGTCATAGGCGTGATTGTGTTTCTTTATGGATGTGCAACAATCGAGGAAGATATTCCCAG
C
AAAGAGATGTGTGACCACCAGAATGCCTTCACCATGTGTCCCCTGTGTGACAAGTCCTGTGACTATTGG
AAC
CTCAGCTCAGCCTGTGGGACTGCACGGGCCAGTCATCTGTTTGACAATCCAGCCACCGTCTTCTTTT
CC
ATCTTCATGGCTCTGTGGGCTACCATGTTTCTGGAAAACTGGAAGAGACTCCAGATGCGGTTGGGCTA
C
TTCTGGGACCTGACTGGGATCGAAGAGGAAGAAGAACGTTCCCAGGAACACTCTCGGCCTGAATATGAA
ACC
AAAGTACGAGAGAAACTGTTAAAGGAGAGTGGCAAGTCAGCGGTTCAGAAGCTGGAAGCAAATTCAC
CT
GAGGATGATGAGGATGATGAAGATAAACTGACTTGGAAAGATCGTTTCCCAGGATACTTGATGAACTT
T
GCCTCCATCTTGTTTATGATTGCCCTGACGTTCTCCATTGTCTTTGGGGTCATTGTGTATCGGATCACA
ACT
GCAGCTGCCCTGTCTCTCAACAAGGCCACACGCTCCAATGTCCGGGTGACAGTGACTGCAACAGCAG
TC
ATCATCAACCTCGTGGTCATCCTCATCTTGGATGAGATCTATGGTGCTGTGGCCAAGTGGCTTACCAA
A
ATCGAGGTTCCGAAAACAGAACAGACTTTTGAAGAACGGTTGATCCTCAAAGCTTTCTTGCTCAAGTTT
GTC
AATGCCTACTCCCCCATCTTCTATGTGGCCTTTTTCAAGGGGAGGTTTGTGGGCAGACCTGGAAGCT
AT
GTCTACGTGTTCGACGGTTACCGCATGGAAGAGTGTGCTCCGGGAGGCTGTCTCATGGAGCTGTGCAT
C
CAACTCAGCATCATCATGTTGGGCAAGCAGCTGATCCAGAACAATATCTTTGAGATTGGAGTCCCGAAG
CTA
AAGAAACTCTTTCGGAAGCTGAAAGATGAGACAGAGCCTGGAGAAAGTGACCCTGACCACTCAAAAC
GT
CCAGAGCAGTGGGACCTGGACCACAGCCTAGAGCCTTACACTGGGCTGACTCCTGAGTACATGGAAAT
G
ATCATCCAGTTTGGTTTTGTCACCCTTTTTGTGGCCTCCTTTCCTCTGGCCCCTGTGTTTGCTCTCCTC
AAC
AATGTCATTGAAGTGCGGCTGGATGCAAAAAAGTTTGTTACAGAACTGAGACGCCCAGATGCTGTGA
GG
ACCAAAGACATTGGAATTTGGTTTGACATTCTCTCTGGAATTGGCAAGTTCTCCGTCATCATTAATGC
T
TTTGTCATTGCTGTCACCTCCGACTTTATCCCCCGCCTTGTGTACCAGTACTCCTATAGCCACAACGGG
ACA
CTACATGGCTTTGTGAACCATACACTCTCCTTTTTCAACGTCAGTCAGCTGAAGGAGGGAACACAGC
CT
GAAAACTCACAGTTCGACCAGGAGGTTCAGTTTTGCAGGTTCAAAGATTATCGAGAACCACCATGGGC
A
CCAAACCCTTATGAGTTTTCCAAGCAGTACTGGTCTGTTTTGTCTGCCCGTCTGGCCTTTGTTATCATC
TTC
CAGAACCTAGTGATGTTCCTGAGTGTCCTGGTGGACTGGATGATTCCGGATATCCCCACTGACATCA
GC
GACCAGATCAAGAAAGAGAAGAGCTTGCTGGTAGACTTCTTTCTGAAGGAGGAGCATGAGAAGGTCAA
G
CTGGCTGATGAGCCCACCCAGAGGAGCCAGGGAGGTGGGGATCGGAGCAGGAGGAGCCGTGCAGCCAGC
TCT
GCACCATCAGGCCGGAGCCAGCCAGGCAGCATAGCATCCTCAGGGTCCCAGCACACCAATGTATGA


Translation (1002 aa):
MAAPGLRDIPLLPGSPRRLSSRTVARGSQGPKHGQQYLKVPGHRAPGQRDNSSLHPSQVSRRESSRDRSV
I
NNYLDANEPPSSEARLSRMHFHDNQRKVDYVLAYHYRKRGAHLGHGSPGHSLAVISNGETGKERHGGGP
G
DVELGPLDALEEERREQRDEFEHNLMAAGLELEKDLE
SKSQGSVFVRIHAPWQVLAREAEFLKIKVPTK
K
MYEIKAGGSIAKKFSAILQTLSSPLQPRVPEHSNNRMKNLSYPFSREKMYLYNIQEKDTFFDNATRSRI
V
HEILKRTACSRANNTM
GINSLIANNIYEAAYPLHDGEYDSPGDDMNDRKLLYQEWARYGVFYKFQPIDL
I
RKYFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSKEMCDHQNAFTMCPLCDKSCDYW
N
LSSACGTARASHLFDNPATVFFSIFMALW
ATMFLENWKRLQMRLGYFWDLTGIEEEEERSQEHSRPEYE
T
KVREKLLKESGKSAVQKLEANSPEDDE
DDEDKLTWKDRFPGYLMNFASILFMIALTFSIVFGVIVYRIT
T
AAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKI
EVPKTEQTFEERLILKAFLLKF
V
NAYSPIFYVAFFKG
RFVGRPGSYVYVFDGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPK
L
KKLFRKLKDETEPGESDPDHSKRPEQWDLDHSLEPYTGLTPEYMEM
IIQFGFVTLFVASFPLAPVFALL
N
NVIEVRLDAKKFVTELRRPDAVRTKDI
GIWFDILSGIGKFSVIINAFVIAVTSDFIPRLVYQYSYSHNG
T
LHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFC
RFKDYREPPWAPNPYEFSKQYWSVLSARLAFVII
F
Q
NLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKVKLADEPTQRSQGGGDRSRRSRAAS
S
APSGRSQPGSIASSGSQHTNV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser