NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS39385.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39385.1 Public Mus musculus 5 Atp5j2 23 108 98 CCDS HistoryNCBI Gene:57423Re-query CCDS DB by CCDS ID:39385.1Re-query CCDS DB by GeneID:57423See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39385.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000161741.7 ENSMUSP00000125504.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000161741.7Link to Ensembl Protein Viewer:ENSMUSP00000125504.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000161741Re-query CCDS DB by Protein ID:ENSMUSP00000125504
Original member NCBI NM_020582.2 NP_065607.1 Updated not alive Link to Nucleotide Sequence:NM_020582.2Link to Protein Sequence:NP_065607.1Re-query CCDS DB by Nucleotide ID:NM_020582Re-query CCDS DB by Protein ID:NP_065607
Current member NCBI NM_020582.3 NP_065607.1 Accepted alive Link to Nucleotide Sequence:NM_020582.3Link to Protein Sequence:NP_065607.1Re-query CCDS DB by Nucleotide ID:NM_020582Re-query CCDS DB by Protein ID:NP_065607Link to BLAST:NP_065607.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065607.1 88 P56135 88 100% 0 0

Chromosomal Locations for CCDS 39385.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 145183839 145183867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 145184532 145184648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 145187126 145187233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 145191503 145191515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (267 nt):
ATGGCGTCACTCGTGCCGCTGAAGGAGAAGAAGCTCATGGAAGTCAAACTTGGAGAGCTGCCGAGCTGGA
TA
ATGATGCGGGATTTCACCCCCAGTGGCATTGCCGGAGCCTTTCGGAGAGGGTATGACCGGTATTACAA
C
AAGTACATCAACGTTCGGAAAGGCAGCATCTCGGGGATTAGCATGGTCCTGGCAGCCTACGTGGTTTTC
AGC
TACTGCATTTCTTACAAGGAACTCAAACATGAGCGGCGACGCAAGTACCACTGA


Translation (88 aa):
MASLVPLKEKKLMEVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGISMVLAAYVVF
S
YCISYKEL
KHERRRKYH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser