NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS39242.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39242.1 Public Mus musculus 5 Oas3 23 108 98 CCDS HistoryNCBI Gene:246727Re-query CCDS DB by CCDS ID:39242.1Re-query CCDS DB by GeneID:246727See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39242.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000044833.8 ENSMUSP00000035588.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044833.8Link to Ensembl Protein Viewer:ENSMUSP00000035588.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000044833Re-query CCDS DB by Protein ID:ENSMUSP00000035588
Original member Current member NCBI NM_145226.2 NP_660261.1 Accepted alive Link to Nucleotide Sequence:NM_145226.2Link to Protein Sequence:NP_660261.1Re-query CCDS DB by Nucleotide ID:NM_145226Re-query CCDS DB by Protein ID:NP_660261Link to BLAST:NP_660261.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660261.1 1138 Q8VI93 1138 100% 0 0

Chromosomal Locations for CCDS 39242.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 120754364 120754375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120754556 120754703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120756027 120756265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120756905 120757080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120758713 120758998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120759921 120760094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120761125 120761269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120761581 120761831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120764244 120764419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120765998 120766277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120769041 120769547 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120769851 120770004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120771011 120771246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120772881 120773056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120773867 120774149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 120777451 120777624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3417 nt):
ATGGACCTGTTCCACACGCCAGCCGGAGCTCTGGATAAGCTGGTGGCCCACAACCTGCACCCAGCCCCTG
AG
TTCACAGCAGCCGTACGGGGTGCTCTGGGGTCGCTAAACATCACCCTACAGCAGCACAGAGCCCGAGG
G
TCACAGAGACCAAGAGTGATAAGGATTGCCAAGGGAGGAGCCTATGCCCGGGGCACAGCTCTCAGAGGT
GGC
ACCGATGTCGAACTCGTCATCTTCCTCGACTGCTTCCAGAGCTTTGGTGACCAGAAGACCTGTCACT
CA
GAGACCCTGGGTGCCATGCGAATGTTGCTGGAGTCCTGGGGGGGCCACCCCGGGCCTGGCCTGACTTT
T
GAGTTTTCTCAGTCAAAGGCGTCCAGGATCTTACAGTTTCGTCTGGCATCGGCAGACGGAGAACACTGG
ATA
GATGTTAGCCTGGTGCCTGCCTTTGATGTCCTAGGACAGCCCCGCTCTGGAGTCAAGCCGACACCCA
AC
GTGTACTCCTCCCTCCTTAGCAGCCACTGCCAGGCCGGGGAGTACTCAGCCTGCTTCACTGAGCCCCG
A
AAGAACTTTGTGAACACTCGCCCAGCCAAGCTTAAGAACTTAATCCTGCTGGTCAAACACTGGTACCAC
CAG
GTGCAGACACGGGCCGTGAGGGCCACACTGCCCCCCAGCTACGCCCTAGAGCTGCTTACCATCTTTG
CC
TGGGAGCAGGGCTGTGGGAAGGACAGCTTCAGCCTGGCCCAAGGGCTCCGGACCGTCCTGGCCTTGAT
C
CAACACAGCAAGTACCTCTGCATTTTCTGGACGGAAAACTATGGCTTCGAGGACCCTGCAGTTGGAGAG
TTC
TTGCGAAGGCAGCTTAAGAGACCCAGGCCCGTGATCCTGGATCCAGCTGATCCAACGTGGGACGTGG
GC
AACGGGACAGCCTGGCGCTGGGATGTGCTGGCCCAGGAGGCTGAGTCCAGCTTTAGCCAGCAGTGCTT
C
AAGCAGGCCTCAGGAGTCCTTGTGCAGCCTTGGGAGGGGCCGGGCCTGCCACGGGCTGGGATCTTGGAT
TTG
GGCCACCCAATCTATCAAGGGCCTAACCAGGCCCTTGAAGACAACAAAGGCCACCTTGCTGTTCAGT
CA
AAGGAAAGGAGCCAAAAACCTTCCAATTCAGCTCCAGGATTTCCAGAAGCAGCCACCAAGATCCCTGC
T
ATGCCCAACCCAAGTGCCAATAAAACCCGCAAGATCCGCAAGAAAGCAGCTCACCCAAAGACTGTCCAG
GAA
GCAGCATTGGATAGTATCTCAAGTCATGTTCGGATCACCCAGAGCACAGCATCCTCACACATGCCTC
CT
GACCGCTCTAGCATCTCCACCGCTGGGTCACGGATGAGCCCAGATCTGTCACAGATCCCCAGCAAGGA
T
CTAGACTGCTTCATCCAGGACCACCTTAGGCCGAGTCCCCAGTTCCAGCAGCAGGTGAAGCAGGCCATC
GAC
GCCATCTTGTGCTGCCTCCGGGAGAAGAGTGTATACAAAGTCTTGAGGGTCAGCAAGGGCGGCTCTT
TC
GGCCGTGGCACAGACCTCAGGGGCAGCTGCGATGTGGAACTTGTCATCTTTTATAAAACCCTCGGGGA
C
TTCAAGGGCCAGAAGCCTCACCAGGCAGAGATCCTGCGTGACATGCAGGCCCAGCTACGACACTGGTGT
CAG
AACCCCGTGCCTGGACTGAGCCTCCAGTTTATTGAACAGAAGCCCAACGCTCTGCAACTCCAGCTGG
CG
TCCACCGACCTCAGCAACCGGGTGGACCTCAGTGTGCTGCCTGCTTTTGATGCTGTGGGGCCGCTGAA
G
TCCGGCACCAAACCTCAGCCCCAGGTGTACTCCTCGCTCCTCAGCAGCGGCTGCCAGGCTGGGGAGCAC
GCA
GCCTGCTTCGCAGAGCTTCGAAGGAACTTCATAAACACTTGCCCTCCCAAACTTAAGAGCCTGATGC
TA
CTGGTCAAACACTGGTACCGCCAGGTTGTCACTCGATATAAAGGAGGAGAGGCGGCAGGTGATGCTCC
G
CCCCCAGCCTACGCCCTGGAGCTCCTGACCATCTTTGCCTGGGAACAAGGCTGTGGAGAGCAAAAGTTC
AGC
CTGGCTGAAGGCCTGCGGACCATCCTGAGGCTGATCCAACAGCACCAGTCGCTTTGTATCTACTGGA
CG
GTCAACTACAGTGTGCAGGACCCGGCCATCAGAGCACATCTTCTCTGCCAGCTTCGGAAAGCCAGGCC
T
CTAGTCCTGGACCCTGCAGATCCCACCTGGAACGTGGGCCAGGGCGACTGGAAGCTATTAGCTCAGGAG
GCA
GCTGCCCTTGGGTCACAAGTCTGCCTTCAGAGTGGGGATGGGACTCTGGTGCCACCCTGGGATGTGA
CG
CCAGCCCTCCTTCACCAGACCCTAGCTGAGGACCTGGACAAATTCATCAGTGAATTCCTCCAGCCCAA
C
CGCCACTTCCTGACTCAAGTGAAGAGAGCCGTGGACACCATATGTTCCTTCCTGAAAGAAAACTGCTTC
CGG
AACTCTACCATCAAGGTGCTCAAGGTGGTCAAGGGTGGGTCTTCTGCCAAAGGCACGGCTCTACAAG
GA
CGCTCAGATGCCGACCTGGTGGTGTTTCTCAGCTGCTTCCGCCAGTTCTCTGAGCAAGGCAGCCATCG
G
GCAGAGATCATCTCGGAGATCCAGGCTCATCTGGAGGCGTGTCAGCAGATGCACAGCTTCGATGTCAAG
TTT
GAGGTCTCCAAGAGGAAGAACCCCCGAGTGCTCAGCTTCACGCTGACATCCCAGACGCTGCTGGACC
AA
AGCGTGGACTTTGACGTCCTGCCAGCCTTTGATGCTCTCGGCCAGCTGAGGTCCGGCTCTCGGCCTGA
T
CCCCGGGTCTACACAGACCTCATCCACAGCTGCAGTAATGCAGGAGAGTTCTCTACCTGCTTCACAGAG
CTG
CAGAGGGACTTCATTACCTCCCGTCCCACCAAACTCAAGAGCCTGATCCGGCTGGTGAAATACTGGT
AC
CAACAGTGTAACAAGACCATCAAGGGGAAGGGTTCCTTGCCTCCCCAGCACGGGCTGGAGCTCCTAAC
T
GTGTACGCCTGGGAGCAAGGTGGCCAGAATCCCCAGTTCAACATGGCGGAGGGCTTCCGCACTGTTCTG
GAG
CTGATTGTCCAGTACCGGCAGCTCTGCGTCTATTGGACCATCAACTACAGCGCAGAAGACAAGACCA
TC
GGTGACTTCCTGAAGATGCAGCTTCGGAAGCCCAGGCCTGTCATCCTGGACCCAGCTGACCCGACAGG
C
AACCTGGGCCACAACGCTCGCTGGGATCTGCTTGCCAAGGAGGCTACCGTGTACGCATCTGCCCTGTGC
TGC
GTGGACAGGGATGGCAATCCCATCAAGCCATGGCCGGTAAAGGCCGCTGTGTGA


Translation (1138 aa):
MDLFHTPAGALDKLVAHNLHPAPEFTAAVRGALGSLNITLQQHRARGSQRPRVIRIAKGGAYARGTALRG
G
TDVELVIFLDCFQSFGDQKTCHSETLGAMRMLLESWGGHPGPGLTFEFSQSKASRILQFRLASADGEHW
I
DVSLVPAFDVL
GQPRSGVKPTPNVYSSLLSSHCQAGEYSACFTEPRKNFVNTRPAKLKNLILLVKHWYH
Q
VQTRAVRATLPPSYALELLTIFAWEQGCGKDSFSLAQGLRTVLALIQHSKYLCIFWTENYGFEDPAVGE
F
LRRQLKRP
RPVILDPADPTWDVGNGTAWRWDVLAQEAESSFSQQCFKQASGVLVQPWEGPGLPRAGILD
L
GHPIYQGPNQALEDNKGHLAVQSKERSQKPSNSAPGFPEAATKIPAMPNPSANKTRKIRKKAAHPKTVQ
E
AALDSISSHVRITQSTASSHMPPDRSSISTAGSRMSPDLSQIPSKDLDCFIQDHLRPSPQFQQQVKQAI
D
AILCCLREKSVYKVLRVSK
GGSFGRGTDLRGSCDVELVIFYKTLGDFKGQKPHQAEILRDMQAQLRHWC
Q
NPVPGLSLQFIEQKPNALQLQLASTDLSNRVDLSVLPAFDAV
GPLKSGTKPQPQVYSSLLSSGCQAGEH
A
ACFAELRRNFINTCPPKLKSLMLLVKHWYRQ
VVTRYKGGEAAGDAPPPAYALELLTIFAWEQGCGEQKF
S
LAEGLRTILRLIQQHQSLCIYWTVNYSVQDPAIRAHLLCQLRKA
RPLVLDPADPTWNVGQGDWKLLAQE
A
AALGSQVCLQSGDGTLVPPWDVT
PALLHQTLAEDLDKFISEFLQPNRHFLTQVKRAVDTICSFLKENCF
R
NSTIKVLKVVK
GGSSAKGTALQGRSDADLVVFLSCFRQFSEQGSHRAEIISEIQAHLEACQQMHSFDVK
F
EVSKRKNPRVLSFTLTSQTLLDQSVDFDVLPAFDAL
GQLRSGSRPDPRVYTDLIHSCSNAGEFSTCFTE
L
QRDFITSRPTKLKSLIRLVKYWYQQ
CNKTIKGKGSLPPQHGLELLTVYAWEQGGQNPQFNMAEGFRTVL
E
LIVQYRQLCVYWTINYSAEDKTIGDFLKMQLRKP
RPVILDPADPTGNLGHNARWDLLAKEATVYASALC
C
VDRDGNPIKPWPVK
AAV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser