NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS39208.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39208.2 Public Mus musculus 5 Plcxd1 23 108 98 CCDS HistoryNCBI Gene:403178Re-query CCDS DB by CCDS ID:39208.2Re-query CCDS DB by GeneID:403178See the combined annotation on chromosome 5 in Sequence Viewer

Public Note for CCDS 39208.2
The coding region has been updated to extend the N-terminus. The use of an alternative upstream start codon would result in a protein that is 12 aa longer at the N-terminal.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 39208.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000086687.9 ENSMUSP00000083892.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000086687.9Link to Ensembl Protein Viewer:ENSMUSP00000083892.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000086687Re-query CCDS DB by Protein ID:ENSMUSP00000083892
Original member NCBI NM_207279.2 NP_997162.2 Updated not alive Link to Nucleotide Sequence:NM_207279.2Link to Protein Sequence:NP_997162.2Re-query CCDS DB by Nucleotide ID:NM_207279Re-query CCDS DB by Protein ID:NP_997162
Current member NCBI NM_207279.3 NP_997162.2 Accepted alive Link to Nucleotide Sequence:NM_207279.3Link to Protein Sequence:NP_997162.2Re-query CCDS DB by Nucleotide ID:NM_207279Re-query CCDS DB by Protein ID:NP_997162Link to BLAST:NP_997162.2

Chromosomal Locations for CCDS 39208.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 110100187 110100325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110101016 110101105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110101388 110101524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110101800 110101928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110102176 110102331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110102446 110102629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 110103395 110103633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1074 nt):
ATGAGCCAGTCAGAGTTGGTCCCCACCCCACCCCTAATGCAGGGACTAGAGCCGAGCAGGGTAGGAAGAG
TG
GGTGAAGTCTGCCGCTCAGTGCATAAGAACGTGTTGACCGTCCCAGAGCACACAGTAGGCACCGAAGC
T
GCAGCTCCCATGGGAGACCAGGCAGACTGGATGTCGCAGCTGTGCCCTCAGCTGTGGGATGTCCCCCTG
CAC
CACCTGTCCATCCCAGGGAGCCACGACACGATGACATACTGCCTGAACCGTAAGTCTCGGATCTCCC
GT
GCAAGTTCGTGGCTACTGCACCTGTTGGGCCGGGTCGTGCCATTCATCACCGGGCCCGTGGTGATGAA
A
TGGTCGGTCACACAGACCCTGGACGTGACGCAGCAGCTGGATGCGGGAGTGCGGTACCTGGACCTGCGG
ATC
GCGCATGCGCCGGAGGGCTCTACACGGAACCTATGCTTCGTGCACATGATGTACACGAAGGCGCTGG
TG
GAGGACACCCTCACTGAGATAGCTGAGTGGCTGCAATCACACCCCCGCGAGGTGGTCATCTTGGCTTG
C
AGGAACTTCGAGGGGATGACTTGTGAGTTGCACGACTATCTCGCGGGCTGCATCGTGAACATTTTTGGA
GAC
ATGCTGTGTCCCAGTGGGGAAGTCCCCACACTGAGGCAGCTATGGGCACGAGAGCAGCAGGTCATCG
TG
TCCTACGAGGATGAGGCCACAGTCAGCCGTTATGATCAGCTGTGGCCTGCGATCCCATATTGGTGGGG
A
AATGCAGTGAAGACAGATGTGCTGCTGCGGTTCCTGGAGACCATGAAGGGCCAAGGCCGCCCAGATGGT
CTG
TTCGTTGCTGGGATCAACATCACTGAGAACCTGTGCTACATCCTCCTGCACCCAGTGGACTCCCTGG
AG
GAGATGACACGTCGCAGCCTCCCCCTCATGACCGAGTGGGTGTGTGCACAGCAGCCGGGGCAGAGCCC
T
CAATGCACCAACATCATCGCAGGCGACTTCGTGGATGCGGATGGCTTCGTGAGTAAGGTCATCAGCCTG
AAT
TGCAAACTGCTGTCTCCCTAA


Translation (357 aa):
MSQSELVPTPPLMQGLEPSRVGRVGEVCRSVHKNVLTVPEHTVGTEAAAPMGDQADWMSQLCPQLWDVPL
H
HLSIP
GSHDTMTYCLNRKSRISRASSWLLHLLGRVVPFITGPVVMKWSVTQTLDVTQQLDAGVRYLDLR
I
AHAPEGSTRNLCFVHMMYTKALVE
DTLTEIAEWLQSHPREVVILACRNFEGMTCELHDYLAGCIVNIFG
D
MLCPSG
EVPTLRQLWAREQQVIVSYEDEATVSRYDQLWPAIPYWWGNAVKTDVLLRFLETMKGQGRPDG
L
FVAGINITENLCYILLHPVDSLEEMTRRSLPLMTEWVCAQQPGQSPQCTNIIAGDFVDADGFVSKVISL
N
CKLLSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser