NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS3909.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3909.1 Public Homo sapiens 5 PRLR 24 110 108 CCDS HistoryNCBI Gene:5618Re-query CCDS DB by CCDS ID:3909.1Re-query CCDS DB by GeneID:5618See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3909.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000618457.5 ENSP00000482954.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000618457.5Link to Ensembl Protein Viewer:ENSP00000482954.1Re-query CCDS DB by Nucleotide ID:ENST00000618457Re-query CCDS DB by Protein ID:ENSP00000482954
Original member Current member NCBI NM_000949.7 NP_000940.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_000949.7Link to Protein Sequence:NP_000940.1Re-query CCDS DB by Nucleotide ID:NM_000949Re-query CCDS DB by Protein ID:NP_000940Link to BLAST:NP_000940.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000940.1 622 P16471-1 622 100% 0 0

Chromosomal Locations for CCDS 3909.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 35065089 35066102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 35068216 35068285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 35068779 35068878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 35070124 35070265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 35072575 35072744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 35084470 35084639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 35086208 35086340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 35089551 35089620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1869 nt):
ATGAAGGAAAATGTGGCATCTGCAACCGTTTTCACTCTGCTACTTTTTCTCAACACCTGCCTTCTGAATG
GA
CAGTTACCTCCTGGAAAACCTGAGATCTTTAAATGTCGTTCTCCCAATAAGGAAACATTCACCTGCTG
G
TGGAGGCCTGGGACAGATGGAGGACTTCCTACCAATTATTCACTGACTTACCACAGGGAAGGAGAGACA
CTC
ATGCATGAATGTCCAGACTACATAACCGGTGGCCCCAACTCCTGCCACTTTGGCAAGCAGTACACCT
CC
ATGTGGAGGACATACATCATGATGGTCAATGCCACTAACCAGATGGGAAGCAGTTTCTCGGATGAACT
T
TATGTGGACGTGACTTACATAGTTCAGCCAGACCCTCCTTTGGAGCTGGCTGTGGAAGTAAAACAGCCA
GAA
GACAGAAAACCCTACCTGTGGATTAAATGGTCTCCACCTACCCTGATTGACTTAAAAACTGGTTGGT
TC
ACGCTCCTGTATGAAATTCGATTAAAACCCGAGAAAGCAGCTGAGTGGGAGATCCATTTTGCTGGGCA
G
CAAACAGAGTTTAAGATTCTCAGCCTACATCCAGGACAGAAATACCTTGTCCAGGTTCGCTGCAAACCA
GAC
CATGGATACTGGAGTGCATGGAGTCCAGCGACCTTCATTCAGATACCTAGTGACTTCACCATGAATG
AT
ACAACCGTGTGGATCTCTGTGGCTGTCCTTTCTGCTGTCATCTGTTTGATTATTGTCTGGGCAGTGGC
T
TTGAAGGGCTATAGCATGGTGACCTGCATCTTTCCGCCAGTTCCTGGGCCAAAAATAAAAGGATTTGAT
GCT
CATCTGTTGGAGAAGGGCAAGTCTGAAGAACTACTGAGTGCCTTGGGATGCCAAGACTTTCCTCCCA
CT
TCTGACTATGAGGACTTGCTGGTGGAGTATTTAGAAGTAGATGATAGTGAGGACCAGCATCTAATGTC
A
GTCCATTCAAAAGAACACCCAAGTCAAGGTATGAAACCCACATACCTGGATCCTGACACTGACTCAGGC
CGG
GGGAGCTGTGACAGCCCTTCCCTTTTGTCTGAAAAGTGTGAGGAACCCCAGGCCAATCCCTCCACAT
TC
TATGATCCTGAGGTCATTGAGAAGCCAGAGAATCCTGAAACAACCCACACCTGGGACCCCCAGTGCAT
A
AGCATGGAAGGCAAAATCCCCTATTTTCATGCTGGTGGATCCAAATGTTCAACATGGCCCTTACCACAG
CCC
AGCCAGCACAACCCCAGATCCTCTTACCACAATATTACTGATGTGTGTGAGCTGGCTGTGGGCCCTG
CA
GGTGCACCGGCCACTCTGTTGAATGAAGCAGGTAAAGATGCTTTAAAATCCTCTCAAACCATTAAGTC
T
AGAGAAGAGGGAAAGGCAACCCAGCAGAGGGAGGTAGAAAGCTTCCATTCTGAGACTGACCAGGATACG
CCC
TGGCTGCTGCCCCAGGAGAAAACCCCCTTTGGCTCCGCTAAACCCTTGGATTATGTGGAGATTCACA
AG
GTCAACAAAGATGGTGCATTATCATTGCTACCAAAACAGAGAGAGAACAGCGGCAAGCCCAAGAAGCC
C
GGGACTCCTGAGAACAATAAGGAGTATGCCAAGGTGTCCGGGGTCATGGATAACAACATCCTGGTGTTG
GTG
CCAGATCCACATGCTAAAAACGTGGCTTGCTTTGAAGAATCAGCCAAAGAGGCCCCACCATCACTTG
AA
CAGAATCAAGCTGAGAAAGCCCTGGCCAACTTCACTGCAACATCAAGCAAGTGCAGGCTCCAGCTGGG
T
GGTTTGGATTACCTGGATCCCGCATGTTTTACACACTCCTTTCACTGA


Translation (622 aa):
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGET
L
MHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYI
VQPDPPLELAVEVKQP
E
DRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWE
IHFAGQQTEFKILSLHPGQKYLVQVRCKP
D
HGYWSAWSPATFIQIPS
DFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFD
A
HLLE
KGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSG
R
GSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
P
SQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDT
P
WLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVL
V
PDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser