NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38985.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38985.1 Public Mus musculus 4 Nphp4 21 106 86 CCDS HistoryNCBI Gene:260305Re-query CCDS DB by CCDS ID:38985.1Re-query CCDS DB by GeneID:260305See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38985.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000056567 ENSMUSP00000049920 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000056567Link to Ensembl Protein Viewer:ENSMUSP00000049920Re-query CCDS DB by Nucleotide ID:ENSMUST00000056567Re-query CCDS DB by Protein ID:ENSMUSP00000049920
Original member Current member EBI,WTSI ENSMUST00000081393 ENSMUSP00000080128 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000081393Link to Ensembl Protein Viewer:ENSMUSP00000080128Re-query CCDS DB by Nucleotide ID:ENSMUST00000081393Re-query CCDS DB by Protein ID:ENSMUSP00000080128
Original member Current member EBI,WTSI OTTMUST00000024971 OTTMUSP00000011441 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024971Link to Vega Protein Viewer:OTTMUSP00000011441Re-query CCDS DB by Nucleotide ID:OTTMUST00000024971Re-query CCDS DB by Protein ID:OTTMUSP00000011441
Original member Current member NCBI NM_153424.2 NP_700473.2 Accepted alive Link to Nucleotide Sequence:NM_153424.2Link to Protein Sequence:NP_700473.2Re-query CCDS DB by Nucleotide ID:NM_153424Re-query CCDS DB by Protein ID:NP_700473Link to BLAST:NP_700473.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_700473.2 1425 P59240 1425 100% 0 0

Chromosomal Locations for CCDS 38985.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 152484406 152484540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152488742 152488894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152496649 152496821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152498177 152498241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152498932 152499087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152502874 152503004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152506361 152506542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152507357 152507483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152518093 152518275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152524242 152524368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152535910 152535971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152537183 152537299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152537775 152537923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152538020 152538211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152538823 152539010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152544299 152544459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152546946 152547126 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152551804 152551929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152554522 152554727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152555473 152555699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152556219 152556405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152556992 152557075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152559328 152559484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152559678 152559763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152560264 152560349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152561178 152561349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152561574 152561753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152562006 152562149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 152562638 152562778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4278 nt):
ATGGGTGACTGGCACAGAGCCTTCACCCAGAACACACTGGTCCCTCCCCACCCACAGAGAGCGAGGCAGC
TT
GGGAAGGAGTCCACGGCATTCCAGTGCATCCTGAAGTGGCTTGACGGGCCACTCATTAAGCAGGGAAT
C
CTAGACATGCTGTCGGAGCTTGAATGCCATCTGCGAGTGACCCTCTTCGATGTCACCTACAAACATTTC
TTT
GGGAGGACGTGGAAAACCACAGTGAAGCCCACCAATCAACCCTCTAAGCAGCCACCTAGGATCACCT
TC
AATGAGCCCTTGTACTTCCACACGACCTTGAGCCACCCCAGCATCGTGGCTGTGGTAGAAGTGGTCAC
C
GAAGGCAGGAAGAGGGACGGCACCCTGCAGCTGCTGTCCTGTGGGTTTGGAATTCTTCGCATCTTTGGC
AAT
AAGCCAGAATCTCCCACCTCTGCAGCCCAGGACAAACGGTTGAGGCTGTATCATGGCACCCCAAGAG
CC
CTCCTGCACCCACTTCTCCAGGATCCCATAGAACAGAACAAGTTCATGAGGCTGATGGAGAATTGTAG
C
CTGCAGTACACCCTGAAGCCACACCCACCCCTGGAGCCCGCCTTCCACCTGCTCCCTGAGAACCTCCTG
GTG
TCTGGTTTCCAGCAGATCCCTGGCCTTCTCCCGCCTCATGGGGACACGGGTGATGCCCTGCGGAAGC
CT
CGCTTCCAGAAGCCCACCACATGGCACTTAGATGACCTCTTCTTCACCCTGTACCCTTCCCTGGAGAA
G
TTTGAGGAGGAACTTGTGCAGCTGCTCATCAGCGACCGGGAGGGGGTCGGCCTGCTGGACAGCGGCACC
CTC
GAGGTCCTGGAGCGGCGCCTGCACGTCTGCGTCCACAACGGGCTGGGCTTCGTGCAGAGGCCACAGG
TG
GTTGTGCTTGTGCCTGAGATGGACGTGGCCTTGACCCGCTCGGCCAGCTTCAGCAGGAAAATCAGTGC
C
TCTTCCAAGAACAGCTCTGGAAATCAGGCTCTAGTTTTGAGAAGCCACCTGCGACTCCCGGAGATGGTC
AGT
CACCCAGCCTTCGCCATCGTCTTCCAGCTGGAGTACGTGTTCAACAGCCCCTCTGGAGCGGATGGCG
GT
GCCAGCTCGCCCACCTCAATATCCAGCGTGGCGTGCATGCACATGGTCCGATGGGCTGTTTGGAACCC
C
GATCTGGAAGTGGGCCCAGGAAAGGTGACGCTGCCTCTTCAGGGTGGGGTTCAGCAAAACCCCTCACGC
TGT
CTGGTCTATAAGGTGCCTTCAGCTAGCATGAGCTCCGAGGAGGTGAAGCAGGTGGAGTCCGGAACCA
TC
CAGTTCCAGTTCTCACTGAGCTCAGACGGCCCCACAGAGCATGCCAACGGCCCCAGGGTGGGGCGTCG
G
TCCTCCCGGAAGATGCCGGCATCCCCTTCAGGCACCCCAGCACCAGCTGCCCGGGATCTTGCTGCAACA
CAG
GACTCTCCTGTGGGCCCAGGGCTCTCGCTCTCCCAGCTGACGGCTTCCCCGCTGTCCCCGGCTCTGC
AA
AGCTCTTCCAAGCCCCCTCTTCAGCCCCCGGACAGCTCTCAGTCCCCAGAGGGTCCCCAGCTCCAGGC
C
GAATCTGTATTAGAGAGCAGGGTCTCTCACCTGGAAGCCGACCTGAGCCAGCCGGCCTCGCTCCAGGGA
ACG
CCTGCTGTCGAGCATCTACAGGAACTTCCCTTCACTCCTCTGCATGCCCCCATCGTCGTGGGAGCAC
AG
ACCAGGAGCTCTAGAAGCCAGCTCTCCAGAGCTGCGATGGTGCTTCTGCAGTCTTCTGGCTTCCCCGA
G
ATCCTTGATGCCAGCCAGCAGCCCGTGGAGGCCGTCAACCCCATAGACCCCGTGAGGTTCAACCCTCAG
AAG
GAGGAGTCGGACTGTCTTCGAGGGAATGAGATTGTGCTGCAGTTTCTTGCCTTCAGCAGAGCCGCCC
AG
GACTGCCCAGGAACGCCGTGGCCACAGACTGTGTATTTCACCTTCCAGTTTTACCGTTTCCCACCCGA
G
ACCACGCCACGCCTGCAGCTGGTCAAGCTGGATGGGACGGGCAAGAGCGGCTCTGGCTCCCTGTCCCAC
ATC
CTCGTCCCCATTAATAAAGATGGCTCCTTTGATGCTGGCTCCCCCGGCCTCCAGCTGAGGTACATGG
TG
GATCCCGGGTTCCTGAAGCCAGGAGAGCAGCGCTGGTTCGCCCACTACCTGGCTGCTCAGACGCTGCA
G
GTCGACGTCTGGGATGGAGACTCCTTGCTCCTCATTGGGTCTGCTGGCGTCCAGATGAAGCACCTCCTC
CGC
CAAGGGCGGCCAGCTGTTCAGGTCTCACACGAACTGGAGGTCGTGGCCACTGAGTACGAACAGGAAA
TG
ATGGCCGTGAGCGGCGATGTGGCTGGCTTCGGCAGCGTCAAGCCCATCGGAGTCCACACGGTAGTGAA
G
GGCCGCCTGCACCTGACCTTGGCCAACGTGGGTCACGCTTGTGAGCCGAGAGCAAGAGGTTCCAACTTG
CTG
CCGCCATCCAGGTCTCGGGTCATCTCAAATGATGGAGCCAGCTTCTTCTCTGGGGGAAGCCTCCTCA
TA
CCCGGAGGCCCCAAGCGAAAGCGTGTGGTACAGGCCCAGAGGCTGGCTGATGTGGACAGCGAGCTGGC
C
GCCATGCTGCTGACACACACTCGAGCTGGCCAGGGGCCCCAGGCTGCAGGCCAGGAGGCAGACGCTGTG
CAC
AAGCGGAAGCTGGAGAGGATGCGGCTGGTGCGCCTGCAGGAGGCTGGAGGGGACTCTGACAGTCGCA
GG
ATCAGCTTGCTGGCCCAACACAGTGTCCGTGCACAGCACTCACGGGACTTGCAGGTCATTGATGCCTA
C
CGGGAACGTACCAAGGCCGAGAGCATTGCCGGAGTGCTAAGCCAGGCCATCACCACCCACCACACGCTG
TAC
GCTACACTGGGCACCGCTGAGTTCTTCGAGTTTGCACTTAAAAACCCACACAACACTCAGCACACGG
TG
GCCATCGAGATCGACAGCCCTGAGCTCAGTATCATCCTGGACAGCCAGGAGTGGAGGTACTTCAAGGA
G
GCCACCGGCCTGCACACGCCCCTGGAGGAGGATATGTTCCACCTGCGTGGGAGCCTGGCACCCCAGCTC
TAC
CTGCGACCCCGGGAGACTGCCCACATCCCCCTTAAGTTCCAGAGCTTCTCCGTGGGCCCTCTTGCTC
CG
ACACAGGCCCCTGCTGAGGTGATCACAGAGAAGGACGCAGAGTCTGGACCCCTTTGGAAGTGCAGCGC
C
ATGCCTACGAAACACGCCAAGGTCCTTTTCCGGGTGGAGACTGGCCAGCTCATTGCTGTGCTCTGCCTG
ACC
GTGGAGCCCCAGCCCCACGTGGTGGACCAGGTTTTCCGCTTCTACCACCCAGAGCTCACGTTCCTGA
AG
AAGGCCATCCGCCTGCCTCCCTGGCACACGCTTCCAGGTGCTCCTGTGGGGATGCCTGGCGAGGATCC
C
CCAGTGCATGTTCGATGCAGTGATCCAAATGTCATCTGTGAGGCCCAGAACGTGGGCCCCGGTGAGCCG
AGA
GATGTGTTCCTTAAGGTGGCCAGTGGTCCAAGCCCGGAGATCAAAGACTTCTTTGTCGTCATCTATG
C
G
GATCGCTGGCTGGCGGTGCCCGTGCAGACGTGGCAGGTCTGCCTCCACTCCCTGCAGCGCGTGGATGT
T
TCCTGTGTCGCAGGACAGCTGACCCGTCTGTCCCTCGTCCTTCGGGGGACACAGACCGTTAGGAAAGTG
AGA
GCTTTCACCTCCCACCCCCAGGAGCTGAAGACAGACCCTGCCGGTGTCTTTGTGTTGCCACCTCATG
GG
GTACAGGACCTGCATGTGGGTGTGAGGCCAAGGAGGGCTGGCAGCCGCTTTGTCCATCTCAACCTAGT
G
GACATAGACTACCATCAGCTGGTTGCGTCATGGCTTGTGTGCCTCTCCTGCCGCCAGCCACTCATCTCC
AAG
GCCTTCGAGATCACCATGGCAGCAGGGGATGAGAAGGGCACCAACAAGCGCATCACCTACACCAACC
CC
TATCCTTCTCGGAGGACCTACCGCCTGCACAGTGACCGTCCCGAGCTGTTGCGCTTCAAGGAGGACTC
C
TTCCAGGTGGCGGGAGGAGAGACCTACACCATCGGCCTGCGGTTCCTGCCAAGTGGCAGCGCCGGGCAG
GAG
GAGATCCTGATCTACATCAATGACCACGAGGACAAGAATGAGGAGACATTCTGTGTGAAGGTCCTCT
AC
CAGTGA


Translation (1425 aa):
MGDWHRAFTQNTLVPPHPQRARQLGKESTAFQCILKWLDGPLIKQGILDMLSELECHLRVTLFDVTYKHF
F
GRTWKTTVKPTNQPSKQPPRITFNE
PLYFHTTLSHPSIVAVVEVVTEGRKRDGTLQLLSCGFGILRIFG
N
KPESPTSAAQDK
RLRLYHGTPRALLHPLLQDPIEQNKFMRLMENCSLQYTLKPHPPLEPAFHLLPENLL
V
SGFQQIPGLLPPHGDT
GDALRKPRFQKPTTWHLDDLFFTLYPSLEKFEEELVQLLISDREGVGLLDSGT
L
EVLERRLHVCVHNGLGFVQRPQVVVLVPEMDVALTRSASFSRKISASSKN
SSGNQALVLRSHLRLPEMV
S
HPAFAIVFQLEYVFNSPSGADGG
ASSPTSISSVACMHMVRWAVWNPDLEVGPGKVTLPLQGGVQQNPSR
C
LVYKVPSASMSSEE
VKQVESGTIQFQFSLSSDGPTEHANGPRVGRRSSRKMPASPSGTPAPAARDLAAT
Q
DSPVGPG
LSLSQLTASPLSPALQSSSKPPLQPPDSSQSPEGPQLQAESVLESRVSHLEADLSQPASLQG
T
PAVEHLQELPFTPLHAPIVVGAQTR
SSRSQLSRAAMVLLQSSGFPEILDASQQPVEAVNPIDPVRFNPQ
K
EESDCLRGNEIVLQFLAFS
RAAQDCPGTPWPQTVYFTFQFYRFPPETTPRLQLVKLDGTGKSGSGSLSH
I
LVPINKDGSFDA
GSPGLQLRYMVDPGFLKPGEQRWFAHYLAAQTLQVDVWDGDSLLLIGSAGVQMKHLL
R
QGRPAVQVSHELEVVATEYEQEMMAVSGDVAGFGSVKPIGVHTVVKGRLHLTLANV
GHACEPRARGSNL
L
PPSRSRVISNDGASFFSGGSLLIPGGPK
RKRVVQAQRLADVDSELAAMLLTHTRAGQGPQAAGQEADAV
H
KRKLERMRLVRLQEAGGDSDSRRISLL
AQHSVRAQHSRDLQVIDAYRERTKAESIAGVLSQAITTHHTL
Y
ATLGTAEFFEFALKNPHNTQHTVAIEIDSPEL
SIILDSQEWRYFKEATGLHTPLEEDMFHLRGSLAPQL
Y
LRPRETAHIPLKFQSFSVGPLAPTQ
APAEVITEKDAESGPLWKCSAMPTKHAKVLFRVETGQLIAVLCL
T
VEPQPHVVDQVFRFYHPELTFLKKAIRLPPWHTLP
GAPVGMPGEDPPVHVRCSDPNVICEAQNVGPGEP
R
DVFLKVASGPSPEIKDFFVVIY
ADRWLAVPVQTWQVCLHSLQRVDVSCVAGQLTRLSLVLRGTQTVRKV
R
AFTSHPQELK
TDPAGVFVLPPHGVQDLHVGVRPRRAGSRFVHLNLVDIDYHQLVASWLVCLSCRQPLIS
K
AFEITMAAGDEKGTNKRITYTNPYPSRRTYRLHSDRPELLRFKEDSFQVAGGETYTIGLRFLPSGSAGQ
E
EILIYINDHEDKNEETFCVKVLYQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser