NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38926.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38926.1 Public Mus musculus 4 Eif4g3 23 108 98 CCDS HistoryNCBI Gene:230861Re-query CCDS DB by CCDS ID:38926.1Re-query CCDS DB by GeneID:230861See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 38926.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000084214.11 ENSMUSP00000081232.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084214.11Link to Ensembl Protein Viewer:ENSMUSP00000081232.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000084214Re-query CCDS DB by Protein ID:ENSMUSP00000081232
Original member Current member NCBI NM_172703.3 NP_766291.2 Accepted alive Link to Nucleotide Sequence:NM_172703.3Link to Protein Sequence:NP_766291.2Re-query CCDS DB by Nucleotide ID:NM_172703Re-query CCDS DB by Protein ID:NP_766291Link to BLAST:NP_766291.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766291.2 1578 Q80XI3-4 1578 99.9366% 0 1

Chromosomal Locations for CCDS 38926.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 138082959 138082988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138087533 138087565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138095909 138095929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138096752 138096931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138097245 138097359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138103315 138103412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138105314 138105436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138120346 138120454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138125810 138126634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138146285 138146373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138151582 138151828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138156612 138156745 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138158391 138158510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138163447 138163617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138165733 138165930 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138170477 138170623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138171055 138171291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138172573 138172677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138175848 138175980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138176938 138177032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138177917 138178010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138180547 138180607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138183128 138183345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138184652 138184767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138188046 138188218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138190615 138190740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138191967 138192048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138194044 138194142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138198079 138198225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138201921 138202002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138203345 138203491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 138205973 138206154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4737 nt):
ATGAACTCACAACCTCAGGCCCGGTCTCCGTTTGCAGCGGGGCCTCGACCTGCCCATCATCAGGGAGGAT
TC
AGACCCATCCAGTTTTTCCAGAGGCCTCAAATCCAGCCTCCCCGAGCTGCCATCCCAAACAGCAGTCC
T
TCCATCCGTCCCGGTGTGCAGACCCCCACCGCCGTGTATCAGGCCAACCAGCACATCATGATGGTTAAC
CAT
CTGCCCATGCCGTACCCCGTGACCCAGGGGCATCAGTACTGCATACCACAGTACCGCCACAGCGGCC
CT
CCGTACGTGGGGCCCCCACAGCAGTATCCAGTTCAGCCGCCTGGGCCGGGGCCTTTTTATCCTGGACC
A
GGACCTGGGGACTTCGCTAATGCTTATGGAACGCCTTTTTACCCAAGTCAGCCAGTGTATCAGTCAGCA
CCT
ATCATAGTGCCTACGCAGCAGCAGCCCCCTCCAGCCAAGAGAGAGAAAAAAACTATAAGAATTCGAG
AT
CCAAATCAGGGAGGTAAAGACATAACAGAGGAGATTATGTCTGGAGGTGGCAGCAGAAATCCCACTCC
A
CCTATAGGAAGACCCGCATCCACTCCCACTCCTCCTCAGCAGCTGCCCAGCCAGGTCCCTGAGCACAGC
CCT
GTGGTATATGGGACTGTGGAGAGCGCTCATCTTGCTGCCAGCACCCCTGTCACTGCAGCTAGCGACC
AG
AAGCAAGAAGAAAAGCCAAAACCAGATCCAGTGTTCCAGTCTCCTTCGACGGTCCTTAGGCTCGTACT
C
AGTGGGGAGAAGAAAGAGCAAGCAGGCCAGATGCCTGAGACTGCTGCAGGAGAGCCCACCCCAGAGCCT
CCT
CGGACTTCATCACCCACCAGCCTTCCTCCACTTGCCCGGAGTTCACTTCCTTCCCCCATGTCCGCTG
CC
CTTAGCAGCCAGCCACTGTTCACTGCTGAGGACAAGTGTGAACTTCCTTCCTCCAAAGAAGAAGATGC
A
CCTCCTGTCCCCAGCCCCACGTCTTGCACAGCAGCCTCAGGCCCTTCACTAACAGATAACAGTGATATA
TGC
AAGAAACCCTGTAGCGTAGCGCCTCATGATAGTCAGCTAATTTCTAGTACTATCCTAATTAATGAAA
TG
AATGGAGTTGGAGAAAAATTATCAGCCAAGGAGAACACTGTGGGCATGCTGAGACAGGAAGTGCTGCC
A
TTGACTCTCGAGTTAGAGATTCTGGAACATCCACAGGAAGAATTGAAAGTGGAATGTACGCCGACTCCC
ATT
GCCCCGTCCATGCTGCCTGCCTTCTCCCCAGCTCCTCCGACTCCCCCCACTTCTCCTCCTTGTCCTC
CG
GTTGTCCTCTCTGCCGCCATTGCTCGTTCTCCCGCTGTTGCCACTGAGGTCCAGAGAGTCGCCGACGA
G
GGAGAAAGCCTGAGAACTTGCCTTAGCAAGGATGCAAAGGAGATGCAGGACAAAGCAGAGTCAGAATCA
GAT
GGGCAAGCAGAAGAGACTGCGGATCCCCAGAGCCTACATTCAGGAAGGAGCCCCGCCCCAGTGCAAA
CA
GCTACCACTGCGCCAAAGTCCTGGAAGAAAACAAAAGAGCAGACCCGAACCCCAGATGAAGTGTTAGA
A
GCAGAGGCAGAGCCTAAAGCCGAAGAAGAGCTTGCAGTTGACAGTGTCCTTGAGCCTGAGCAAGAGAAG
ATG
AGCCAAGGGTTTCCGTCTGAGAGAGACCCCTCTGCCCTGAAGAGAGGGAAAGCTGAGGAAGGAAACG
GA
GAAGAGGCTGAGCCTGTGCGAAATGGCGCTGAGAGTGCTTCTGAGGGGGAAGGGGGAGATGGCAACTC
A
GGCTCTGCTGACAGCTCTGCTGATGGGCTCACCTTCCCGTTTAAAGCAGAGTCCTGGAAGCCTGCAGAT
ACA
GAAGGCAAGAAGCAGTATGACCGGGAGTTCCTACTGGACATCCAGTTTATGCCCGCCTGTATCCAAA
AA
CCAGAAGGCCTGCCTCCCATCAGCGACGTGGTCCTTGACAAGATCAACCAGCCCAGATTGTCAATGCG
G
ACCCTGGATCCTCGCATTTTGCCTCGAGGACCTGACTTCACCCCAGCCTTTGCAGACTTTCCAAGGCAA
ACG
CCTGGTGGAAGAGGTGTGCCTCTGTTGAATGTTGGACCTCGGAGGTCTCAACCTGGCCAGAGAAGGG
AG
CCCAGAAAGATAATCACTGTCTCCGTAAAAGAAGATGTGCACTTGAGAAAGGCGGAGAATGCCTGGAA
G
CCGAGCCAGAAACGGGACAGCCACGCCGATGACCCCGAAAGCATTAAAACTCAGGAACTTTTCAGAAAA
GTT
CGAAGTATCTTGAATAAACTGACACCACAGATGTTCAACCAGCTGATGAAGCAAGTGTCGGCTCTTA
CG
GTGGACACGGAGGAGCGGCTAAAAGGGGTCATCGACCTTGTCTTTGAGAAGGCTATCGATGAGCCCAG
C
TTCTCTGTGGCGTACGCAAACATGTGTCGGTGCCTAGTAACGCTGAAGGTGCCCATGGCAGACAAGCCT
GGC
AACACAGTGAATTTCCGGAAGCTGCTGCTTAACCGCTGCCAGAAGGAGTTCGAGAAAGACAAAGCAG
AT
GATGACGTCTTTGAGAAGAAGCAGAAAGAACTGGAAGCTGCCAGCGCTCCAGAGGAGAGGACAAGGCT
T
CACGACGAACTGGAAGAAGCCAAGGACAAAGCCCGGCGGAGATCCATCGGCAACATCAAGTTCATTGGA
GAA
CTCTTTAAACTGAAAATGCTGACGGAGGCCATCATGCATGACTGTGTGGTGAAGCTCCTGAAGAACC
AC
GATGAAGAGTCCCTGGAGTGCCTGTGTCGCCTGCTCACCACCATCGGCAAAGACCTGGACTTTGAGAA
A
GCAAAGCCACGCATGGACCAGTACTTTAACCAGATGGAGAAAATCGTCAAAGAAAGAAAAACTTCCTCC
AGA
ATTCGGTTCATGCTTCAGGATGTAATCGACCTCAGACTGTGTAATTGGGTGTCCCGAAGAGCAGATC
AG
GGGCCAAAAACTATCGAGCAGATTCACAAAGAGGCCAAAATAGAAGAACAAGAGGAGCAGAGGAAAGT
C
CAGCAGCTGATGACCAAGGAGAAGAGGAGACCAGGCGTCCAAAGAGTGGATGAAGGTGGATGGAATACT
GTA
CAAGGGGCCAAGAACAGTCGTGTACTGGACCCCTCCAAATTTTTGAAAATTACTAAACCCACCATTG
AT
GAGAAGATTCAGCTGGTTCCTAAGGCACAGCTGGGCAGCTGGGGCAAAGGCAGCAGCGGGGGAGCAAA
G
GCAAGTGAGTCCGCACCTTCAGGGTCCCCGTCGGCCACACCCTTAGAGTTTGATTCCCGAAGGGCGTTA
ACC
AGTCGTGGGAGCATGGGCAGGGAGAAGAGCGACAAGCCAATTCCAGCTGGAACAGCCCGTCCCAACA
CG
TTCCTGAGGGGCAGCAGCAAAGACCTGCTGGACAACCAGTCCCAGGAAGAGCAGCGCAGAGAGATGTT
G
GAGACCGTGAAACAGCTGACAGGAGGCCTGGATGCTGAGCGGGCCAGCACTGAGGCCGACCGAAGCAAA
ACG
AGGGAGCTAGCAAAATCGGAAATGTGTGCAGTGCCAGCCCCTGACAAGCCTGCACTGTCAGAAGAGG
AA
GTGGAGAGGAAGTCCAAGTCTATCATTGACGAATTCTTACACATCAATGACTTTAAGGAGGCCACGCA
G
TGCATAGAGGAGCTGAGCGCCCAGGGCCCACTGCATGTGTTCGTGAAGGTGGGTGTGGAGTTCACCCTG
GAA
CGGAGCCAGATCACCAGGGACCACATGGGCCACTTACTGTATCAGCTGGTGCAGTCAGAAAAACTCA
GC
AAGCAGGACTTTTTCAAAGGTTTTTCTGAAACCTTGGAGTTGGCAGATGACATGGCCATTGATATTCC
C
CATATTTGGTTGTACCTGGCTGAACTGGTCACCCCCATGTTAAAAGGAGGGGGGATTTCCATGAGAGAA
CTT
ATTGTGGAATTCAGCAAGCCATTACTTCCTGTTGGCAGAGCTGGGGTCCTGCTTTCTGAAATCCTAC
AC
CTTCTATGCAGACAAATGAGCCATAAGAAAGTAGGCGCCCTGTGGAGGGAGGCTGACCTCAGCTGGAA
G
GACTTTTTACCGGAAGGGGAAGATGTCCATCATTTTCTCTTGGAGCAGAAGTTGGACTTCACGGAATCC
GAA
GGGCCCTGCTCCTCTGAGGCACTGTCAAAGAAGGAGCTGTCTGCCGAGGAGCTGTCTCAGCGCCTGG
AA
AAGCTCATCATGGAGGAGAAAGCGGATGACGAGCGGATCTTTGACTGGGTGGAGGCTAATCTCGACGA
A
AGCCAGATGAGTTCGCCTACATTCCTTAGAGCTTTAATGACAGCCGTTTGCAAAGCAGCTATCATAGCT
GAC
TGTTCTACCTTCAGAGTGGACACTGCTGTGATCAAGCAGAGAGTGCCGATCTTACTCAAGTACCTAG
AC
TCAGACACGGAGAAGGAACTACAAGCACTTTATGCACTACAAGCATCCATAGTAAAACTTGACCAACC
T
GCCAACTTGCTCCGGATGTTTTTTGATTGCCTGTATGACGAGGAGGTGATATCAGAGGATGCCTTCTAC
AAA
TGGGAGAGCAGCAAGGACCCCGCTGAGCAAGCTGGGAAGGGCGTGGCCCTCAAGTCTGTCACGGCCT
TT
TTCACGTGGCTTCGAGAAGCAGAAGAGGAGTCCGAGGATAACTAA


Translation (1578 aa):
MNSQPQARSPFAAGPRPAHHQGGFRPIQFFQRPQIQPPRAAIPNSSPSIRPGVQTPTAVYQANQHIMMVN
H
LPMPYPVTQGHQYCIPQ
YRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFANAYGTPFYPSQPVYQSA
P
IIVPTQQQPPPAKREKKT
IRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPASTPTPPQQLPSQVPEHS
P
VVYGTVESAHLAASTPVTAASDQKQ
EEKPKPDPVFQSPSTVLRLVLSGEKKEQAGQMPETAAGEPTPEP
P
RTSSPTSLPPLARSSLPSPMSAALSSQPLFTAEDKCELPSSKEEDAPPVPSPTSCTAASGPSLTDNSDI
C
KKPCSVAPHDSQLISSTILINEMNGVGEKLSAKENTVGMLRQEVLPLTLELEILEHPQEELKVECTPTP
I
APSMLPAFSPAPPTPPTSPPCPPVVLSAAIARSPAVATEVQRVADEGESLRTCLSKDAKEMQDKAESES
D
GQAEETADPQSLHSGRSPAP
VQTATTAPKSWKKTKEQTRTPDEVLEAEAEPKAEEELAVDSVLEPEQEK
M
SQGFPSERDPSALKRGKAEEGNGEEAEPVRNGAESASEGEGGDGNSGSADSSADGLTFPFKA
ESWKPAD
T
EGKKQYDREFLLDIQFMPACIQKPEGLPPISDVVLDK
INQPRLSMRTLDPRILPRGPDFTPAFADFPRQ
T
PGGRGVP
LLNVGPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHADDPESIKTQELFRK
V
RSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVT
LKVPMADKP
G
NTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASA
PEERTRLHDELEEAKDKARRRSIGNIKFIG
E
LFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAK
PRMDQYFNQMEKIVKERKTSS
R
IRFMLQDVIDLRL
CNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNT
V
QGAKNSRVLDPSKFLKITK
PTIDEKIQLVPKAQLGSWGKGSSGGAKASESAPSGSPSATPLEFDSRRAL
T
SRGSMGREKSDKPIPAGTARPNTFLRGSSKDLLDNQSQEEQRREMLETVKQLTGGLDAERASTEADRSK
T
REL
AKSEMCAVPAPDKPALSEEEVERKSKSIIDEFLHINDFKEATQCIEELSAQGPLHVFVKVGVEFTL
E
RSQITRDHMGHLLYQLVQSEKLSKQDFFK
GFSETLELADDMAIDIPHIWLYLAELVTPMLKGGGISMRE
L
I
VEFSKPLLPVGRAGVLLSEILHLLCRQMSHKKVGALWREADLSWKDFLPEGEDVHHFLLEQKLDFTES
E
GPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVE
ANLDESQMSSPTFLRALMTAVCKAAIIA
D
CSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPA
NLLRMFFDCLYDEEVISEDAFY
K
WESSKDPAEQAGKGVALKSVTAFFTWLREAEEESEDN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser