NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3866.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3866.1 Public Homo sapiens 5 NDUFS6 22 109 92 CCDS HistoryNCBI Gene:4726Re-query CCDS DB by CCDS ID:3866.1Re-query CCDS DB by GeneID:4726See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3866.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000274137.9 ENSP00000274137.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000274137.9Link to Ensembl Protein Viewer:ENSP00000274137.5Re-query CCDS DB by Nucleotide ID:ENST00000274137Re-query CCDS DB by Protein ID:ENSP00000274137
Original member NCBI NM_004553.4 NP_004544.1 Updated not alive Link to Nucleotide Sequence:NM_004553.4Link to Protein Sequence:NP_004544.1Re-query CCDS DB by Nucleotide ID:NM_004553Re-query CCDS DB by Protein ID:NP_004544
Current member NCBI NM_004553.5 NP_004544.1 Accepted alive Link to Nucleotide Sequence:NM_004553.5Link to Protein Sequence:NP_004544.1Re-query CCDS DB by Nucleotide ID:NM_004553Re-query CCDS DB by Protein ID:NP_004544Link to BLAST:NP_004544.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004544.1 124 O75380 124 100% 0 0

Chromosomal Locations for CCDS 3866.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 1801418 1801549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1802321 1802374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1814339 1814461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 1815851 1815916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (375 nt):
ATGGCGGCGGCGATGACCTTCTGCCGGCTGCTGAACCGGTGTGGCGAGGCGGCGCGGAGCCTGCCCCTGG
GC
GCCAGGTGTTTCGGGGTGCGGGTCTCGCCGACCGGGGAGAAGGTCACGCACACTGGCCAGGTTTATGA
T
GATAAAGACTACAGGAGAATTCGGTTTGTAGGTCGTCAGAAAGAGGTGAATGAAAACTTTGCCATTGAT
TTG
ATAGCAGAGCAGCCCGTGAGCGAGGTGGAGACTCGGGTGATAGCGTGCGATGGCGGCGGGGGAGCTC
TT
GGCCACCCAAAAGTGTATATAAACTTGGACAAAGAAACAAAAACCGGCACATGCGGTTACTGTGGGCT
C
CAGTTCAGACAGCACCACCACTAG


Translation (124 aa):
MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAID
L
IAEQPVSEVETRVIACDGGGGALGHPKVYINL
DKETKTGTCGYCGLQFRQHHH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser