NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38621.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38621.1 Public Mus musculus 3 Sec24d 21 106 86 CCDS HistoryNCBI Gene:69608Re-query CCDS DB by CCDS ID:38621.1Re-query CCDS DB by GeneID:69608See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38621.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000047923 ENSMUSP00000035823 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000047923Link to Ensembl Protein Viewer:ENSMUSP00000035823Re-query CCDS DB by Nucleotide ID:ENSMUST00000047923Re-query CCDS DB by Protein ID:ENSMUSP00000035823
Original member Current member EBI,WTSI OTTMUST00000131727 OTTMUSP00000070376 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000131727Link to Vega Protein Viewer:OTTMUSP00000070376Re-query CCDS DB by Nucleotide ID:OTTMUST00000131727Re-query CCDS DB by Protein ID:OTTMUSP00000070376
Original member Current member NCBI NM_027135.2 NP_081411.2 Accepted alive Link to Nucleotide Sequence:NM_027135.2Link to Protein Sequence:NP_081411.2Re-query CCDS DB by Nucleotide ID:NM_027135Re-query CCDS DB by Protein ID:NP_081411Link to BLAST:NP_081411.2

Chromosomal Locations for CCDS 38621.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 123269636 123269753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123279145 123279268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123290416 123290564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123293578 123293853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123294159 123294292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123299557 123299668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123305793 123305920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123327508 123327646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123330324 123330439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123336486 123336610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123343041 123343232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123343824 123343917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123349909 123350025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123350700 123350870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123353390 123353486 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123353576 123353721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123354947 123355085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123355723 123355841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123358837 123359016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123360820 123361011 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123362634 123362723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 123364821 123364961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3099 nt):
ATGAGCCAACAAGGCTATGTGGCGACACCCCCTTATTCTCAGTCCCAGCCTGGAATGGGTATCTCTCCCC
CT
CACTACGGACACTATGGGGACCCGTCCCATGCATCCTCTCCACCAGGCGTGATGAAGCCATTGGGGCC
T
TCAGCTGCTCCTTCAGGGATGCTGCCCCCAGGTCCTTTACCTCCTGGACCCCCACAGTTTGGCCCCAAT
GGA
GCCCATACTCCAGGCCATCCTCCTCAAAGATTTCCAGGACCCCCACCTGTCAATAGTGTGGCACCCT
CT
TATGCGTCAGGCCAGACCCTGCCACAGTCATCTTACCCAGGCCCTGGGTCCACTTCCTCTGTCACCCA
G
CTGGGCAGTCAGTTCAGCTCCATGCAGATCAACAGCTATGGTGTGGGCGCGACTCCTCAGAGCCAGGGT
CCG
CCTGGCCCCCAGTCAGCAGGCGCCTTCCAGGGGCCTCCACAACCTGCACAGCCATCTATTCTGCAGC
CA
GGACATCAGGTTCCGCCGCCACCCCCCACTGCCCTGAACGGCCCTGGTGCCTCTCCTATGTCTCCACC
A
ACTCACAGGCAAGATGGCCTTCCTGGGCCAGCTCCTCTGAACGCCCAGTATCAGCCCCCACCTCCACCA
GGC
CAGACCCTGGGTCCTGGCTACCCTCCACAGCAAGCAACCAACTATGGACCGCAGATGGGAGGTGCAC
AG
ATGTCTTACCCAGGAGGGTTCCCTGGAGGTCCTGCCCAGATGGCTGGGCCGGCACCACAGCTCCAGAG
G
AAGCTGGATCCGGACTCCATCCCCAGCCCTATTCAAGTGATCGAGAATGACAGGGCCACCAGAGGTGGA
CAA
GTCTATACGACCAATACCAGGGGCCAGGTACCTCCACTGGTCACCACCGAGTGTGTGATTCAAGACC
AA
GGCCACTCGAGCCCCCGCTATATCCGCTGCACTACGTATTGCTTTCCGTGCACGTCCGACATGGCCAA
G
CAAGCTCAGATCCCACTGGCTGCCGTCATCAAACCCTTCGCTGACATTCCGCCCAACGAGACCCCCTTG
TAC
TTGGTAAACCATGGGGAGAGTGGACCAGTGAGGTGCAACAGGTGCAAAGCCTACATGTGCCCGTTCA
TG
CAATTCATCGAAGGCGGACGGCGCTATCAGTGCGGATTCTGCAGCTGTGTGAATGAAGTCCCACCATT
C
TATTTCCAACATCTGGACCACATTGGAAGGAGATTGGACCACTATGAGAAGCCAGAGCTGTCGCTGGGA
TCC
TATGAATATGTTGCTACATTGGATTACTGCAGAAAGAATAAACCTCCCAGCCCACCAGCCTTCATCT
TC
ATGATTGATGTCTCATATAGTAACATAAAGAATGGCCTCGTCAAGCTCATATGTGAAGAGCTGAAGAC
C
GCGCTGAAGCGGCTACCCAAGGAGGAGCATGAGGAGACGTCTGCAATCCGAGTTGGTTTCATCACATAC
AAC
AAAGTTCTCCACTTCTTTAACGTGAAGAGTAATCTGGCCCAGCCTCAGATGATGGTGGTGACGGATG
TC
GGAGAGGTCTTTGTTCCTTTGTTGGATGGGTTCCTTGTCAACTATGAAGAATCTCAATCTGTGATCCA
C
AATTTATTGGACCAGATTCCTGAGATGTTTGCTGACTCTAATGAAAACGAGACAGTCTTTGCCCCGGTC
ATC
CAGGCCGGCATGGAGGCCCTGAAGGCAGCAGAGTGCCCGGGGAAGCTCTTCATCTTCCATTCCTCTT
TG
CCTACTGCCGAAGCACCGGGGAAGCTCAAGAACAGAGACGACAAAAAGCTGGTGAACACAGACAAAGA
G
AAGATACTTTTCCAGCCCCAAACAGCTGTCTACGAATCTCTGGCCAAAGACTGTGTGGCCAACAGCTGC
TCA
GTGACTCTGTTCCTCTTCCCCAGTCAGTTTGTGGATGTGGCTTCCTTGGGTCTGGTTCCTCTGCTCA
CG
GGAGGAACTCTTTACAAATACAACGTTTTCCAGATACATTCAGATAGCCAAAGGTTTCTGACCGACCT
C
CGGAATGATATTGAGAAGAAAATAGGCTTCGATGCTATCATGAGGGTTCGGACCAGCACAGGTTTCAGG
GCC
ACTGATTTCTTTGGTGGAATATTCATGAACAACACCACAGATGTGGAAATGGCGGCCATCGACTGCG
AT
AAAGCCGTGACAGTGGAGTTCAAGCACGATGACAAGCTCAGTGAAGATGTCGGGGCCCTGATCCAGTG
T
GCTGTGCTCTACACGACCATCAGTGGTCAGCGAAGACTCCGGATTCACAATCTCGCCTTAAACTGCAGC
ACC
CAGCTAGCGGATCTGTACAAGAGCTGTGAAACTGATGCCCTTATCAACTTCTTTGCCAAGTCAGCTT
TT
AAAGCAGTTTTGAACCAGCCCTTGAAGGCCATCCGGGAAATTCTAGTCAATCAGACTGCCCATATGCT
G
GCGTGTTACCGGAAGCACTGTGCGAGTCCGTCTGCAGCAAGCCAGCTTATACTGCCAGATTCCATGAAG
GTG
CTGCCTGTGTACATGAACAGTTTGTTGAAAAACTGTGTGCTGCTCAGCAGATCGGAGATCTCCCCTG
AT
GAGCGGGCTTACCAGCGGCAGCTGGTCATGACCATGGGCGTGGCTGACTCCCAGCTCTTCTTCTATCC
A
CTGCTCCTGCCAATCCACACGTTAGATGTGAAGAGTGCAGCGCTGCCACCAGCCGTCCGCTGCTCCGAG
TCC
CGACTCTCTGAAGAAGGAATATTCCTGCTGGCTAACGGTCTGAACATGTTCTTATGGTTTGGAGTGG
GC
AGCCCACCAGAGCTGATTCAGGGAATATTTAATGTGCCATCGTTTGCACATATCAACACAGATATGAC
A
TCGCTGCCTGAGGTGGGAAGTCCACACTCTCAACAACTCAGAATGATAATGAATAATATCCAGCAAAAG
AAG
CCATACTCAATGAAGCTCATCGTGGTTAAACAGCGAGAGCAGCGGGAGATGGCTTTCCGACAGTTCC
TG
GTGGAAGATAAAGGGCTCTATGGAGGATCTTCGTACGTGGATTTCCTCTGCTGTGTTCACAAGGAGAT
C
TGTCAACTGCTTAACTGA


Translation (1032 aa):
MSQQGYVATPPYSQSQPGMGISPPHYGHYGDPSHASSPPGVMKPLGPSAAPSGMLPPGPLPPGPPQFGPN
G
AHTPGHPPQ
RFPGPPPVNSVAPSYASGQTLPQSSYPGPGSTSSVTQLGSQFSSMQINSYGVGATPQSQG
P
PGPQSAGAFQGPPQPAQPSILQPGHQVPPPPPTALNGPGASPMSPPTHRQDGLPGPAPLNAQYQPPPPP
G
QTLGPGYPPQQ
ATNYGPQMGGAQMSYPGGFPGGPAQMAGPAPQLQRKLDPDSIPSPIQVIENDRATRGG
Q
VYTTNTRGQVPPLVTTECVIQDQ
GHSSPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFADIPPNETPL
Y
LVNHGESGPVRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNE
VPPFYFQHLDHIGRRLDHYEKPELSLG
S
YEYVATLDYCR
KNKPPSPPAFIFMIDVSYSNIKNGLVKLICEELKTALKRLPKEEHEETSAIRVGFITY
N
KVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYEESQSVIH
NLLDQIPEMFADSNENETVFAPV
I
QAGMEALK
AAECPGKLFIFHSSLPTAEAPGKLKNRDDKKLVNTDKEKILFQPQTAVYESLAKDCVANSC
S
VTLFLFPSQFVDVASLGLVPLLTGGTLYKYNVFQ
IHSDSQRFLTDLRNDIEKKIGFDAIMRVRTSTGFR
A
TDFFGGIFMNNTTDVEMAAIDCDKAVTVEFKHDDKLSEDVGALIQ
CAVLYTTISGQRRLRIHNLALNCS
T
QLADLYKSCETDALINFFAKS
AFKAVLNQPLKAIREILVNQTAHMLACYRKHCASPSAASQLILPDSMK
V
LPVYMNSLLKNCVLLSRSEISPDERAYQRQLVMTMGVADSQLFFYPLLLPI
HTLDVKSAALPPAVRCSE
S
RLSEEGIFLLANGLNMFLWFGVGSPPELIQGIFNVPSFAHINTDM
TSLPEVGSPHSQQLRMIMNNIQQK
K
PYSMK
LIVVKQREQREMAFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser