NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38558.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38558.1 Public Mus musculus 3 Ankrd35 23 108 98 CCDS HistoryNCBI Gene:213121Re-query CCDS DB by CCDS ID:38558.1Re-query CCDS DB by GeneID:213121See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38558.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000048427.8 ENSMUSP00000047244.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000048427.8Link to Ensembl Protein Viewer:ENSMUSP00000047244.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000048427Re-query CCDS DB by Protein ID:ENSMUSP00000047244
Original member Current member NCBI NM_001081139.1 NP_001074608.1 Accepted alive Link to Nucleotide Sequence:NM_001081139.1Link to Protein Sequence:NP_001074608.1Re-query CCDS DB by Nucleotide ID:NM_001081139Re-query CCDS DB by Protein ID:NP_001074608Link to BLAST:NP_001074608.1
Original member Current member NCBI NM_001356538.1 NP_001343467.1 Accepted alive Link to Nucleotide Sequence:NM_001356538.1Link to Protein Sequence:NP_001343467.1Re-query CCDS DB by Nucleotide ID:NM_001356538Re-query CCDS DB by Protein ID:NP_001343467Link to BLAST:NP_001343467.1

Chromosomal Locations for CCDS 38558.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 96670411 96670449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96678133 96678263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96679180 96679268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96679630 96679694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96680471 96680528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96680627 96680697 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96680962 96681068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96682027 96682211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96682994 96683031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96683183 96685174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96689146 96689235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96689445 96689510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 96690192 96690251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2991 nt):
ATGAAGCGCATCTTCTCCTGCTCCAGTTCACAAGTGGCGGTGGAGAAATGGAACCGACGTGATCAGAAGC
TG
CTGGAGGCGGTGCAGCGGGGGGACGTGGGACGCGTGGCTGCCTTGGCCTCTAGGAAGTCAGCCCGACC
C
ACCAAACTAGACTCAAATGGCCAGTCCCCGTTCCATCTGGCAGCCTCCAAAGGCCTGACAGAGTGTCTG
ACA
ATACTGCTTGCAAATGGGGCTGATATCAACAGCAAGAACGAGGACGGAAGCACTGCCCTTCATTTGG
CC
ACCATCTCCTGTCAGCCACAGTGTGTGAAGGTCTTGCTTCAGCACGGTGCTAATGAAGATGCTGTGGA
T
GCAGAAAATCGCAGTCCATTACACTGGGCAGCCTCCTCTGGCTGCGCCTCAAGTGTCCTCCTGCTGTGT
GAC
CACGAAGCCTTCCTGGACGTGCTGGATAATGATGGACGCACACCCCTGATGATTGCATCGCTGGGTG
GT
CATGCAGCTATCTGCTCACAGCTGTTGCAGAGAGGTGCCCGAGTTAATGTCACAGACAAGGATGACAA
A
TCAGCTTTGATCCTGGCCTGTGAGAAAGGCAGCGCTGAGGTGGCCGAGCTGCTCCTGAGCCATGGAGCG
GAC
GCTGGAGCGGTGGACAGTTTGGGACACAACGCTCTTCATTATGCTTTGCGTACACAAGACAAGGAGC
TG
TGGAGGCTGTTACAGCAGGCCCTGAACCGGCGGCGGAGAGGCGGTCATGGACTGGTTCAACACCCAGA
T
CACCCATCTCAGGCCTCTTCATGTGAGCCTCGGGTGGGATCTCCTCCTAAGAACTCACGGAAAGTGGAG
CCT
GAGGAAGAGCAGGAGGAGGAGGGGGAGGAGCGGTGCTCAGAAGAGTGGAGGTGGAAGTTCGAGGAGG
AG
CAGAGGAAAGTTCATCAGCTGGAGCAGGAGCTCGTGCGAAAGACAGATGAGTGCAAGGCTCACGCTGC
A
GCCTTCTCAAGCCTAGAGGAGCAGATTCGAGAGCAAGCGCAAGAACTAGGCCATCTCCTAGTGCAAGAA
CCG
GGAGCTCCAGGAAATCAAGGCCCTGGTCTCCGGCCTGAGGGAGATGGTATGGAGGAGGGTTGTCCCC
TG
AACCTGCTGGCTGAGCGGATCCAAGAGCTGAAGAAGCAGCAGAAGGCACTGGCTACAATAAACCCAAC
A
TTAGTTCCCAAGAGAGCTGAAGAATTAGCCCCGGCTGAGATCCATCATGAAGTACACAGAAAGTCCCAA
CCA
GAGCAGGGGCTGCCCCAGGGCCCAAGTTCAGAAACCACCGGGAAAGCCACAGGACAGCAACCAAACA
CC
AATGGGGGGCAGAACCTTGGCCTCCAGAACACTGAGCAGGTGTGTGCTGGCCAGAAGGAGAGGACCCC
A
GCTCCAGGGACTGAAACAGCAGGCACAGTGGGAGAACCAGTGGGCATAGCCATGAATCAGCTCCTCCTA
CAG
CTAAGGGAAGAGCTGGCTGCAGTGTGGCGAGAAAAGGATGCTGCCAGAGGGGCTTTGTCAAGACCAG
TT
CTGGAGGGAGCCCTGGGGACTCCCAGAGCTGAGGCTGCAGCAGCTGCCTGGGAAAAGATGGAAGCCAG
G
CTTGAGAGGGTGCTGGTAAGGTTAGATGGAGCAAAGATGGGACTGCATGTGAAACCTGAGGTCCCTGTC
CAG
GGGTCCAGAGACGGAGCCCCGAAGGCAGTCCCGGGATGCTCTAAAGAGCAGGAAGAAAAGAAGGCTC
TT
GGAACCAGAGGAGAGCCCTTAGGGGCCCCTGGAAAAGAACAGGCCTTAGGAGGAGGCCTGGCAAAGGG
A
CAGCTGGAGAAAGAGGTGTCAGCTTTGAGACTGAGCAATAGCAACTTGCTGGAGGAATTGGGAGAGTTG
GGG
CGCGAGAGACAACGCTTGCAGGGAGAGCTGCAGTCCTTGACCCAGAGGCTACACCGGGAGTTTGTGC
CC
AAGCCCGAGGCACAGGTCCAGCTACAGCAGTTGCGGAGGAGCGTGGGGATGTTGACAGAGGAACTGGC
C
ATGGAGAAGGAGGCCACAGATAAGCTGCGCAGGCTACTGGCCTCCCAGACTAGCGGCCTCCAAGGACTG
TGG
AAATGCCTACCCCCAGACCTCGTGGGCAAGGGGAATACACAGAGTACAGCTGCAGAACCCCTGGAGG
AG
CTGCAGGCCTGCATCAGCACCCTGGTGGATAGGCACCTTGAGGCTCAACGGGTGCTGGCTCGGTTGGA
A
GAGGAAAACCAGCAGCTGAGGGGATCCTTGGCTCCCTGTGGGGAACCAGAGGCCTCCCTCAAGGTTACA
GCA
TCCCCGCAAGTGGCCGCCCTGGAGGAAGATCTGGGAATGCTAGAGGAAGAGCTACGGGCCGTGCAGG
CC
ACGATGAGTGGGAAGAGCCAGGAGATTTGCAAGCTGAAACAACTGCTCTACCAAGCCACGGAAGAAGT
G
GCCGAGCTGAGAGCTCGGGAAGCAGCCAGCCTGCGCCAGCACGAGAAGACGCGAGGCTCGCTGGTGGCC
CAG
GCACAGGCTTGGGGCCAGGAGCTCAAAGTCGTGCTGGAGAAGTACAACACAGCCTGTCGGGAAATGA
CT
CGATTGCGGGACACTGTGGCGGAGGAACGTCGCCGCAGCGAGGACCTGGCGGCTAGGGCGGCGGAGCA
G
GAGCGCCAGGCTGGCGAGATGCGCGGGCGCTCGGAGCAGTTCGAGAAAACTGCTGAGCTCCTGAAAGAG
AAG
ACAAACCACCTCATCGGGGCTTGCCGGGACAAGGAAGCCAAGATCAAGGAGTTGCTGAAGAAGCTCG
AG
CAGCTTTCGGAAGAAGTTCTAGAAGTCCGGGGCGAGAATGCCCACCTCGCCCTACAGCTGCAGGACTC
C
CAGAAGAACCACGAAGAGATCATCTCCACATACAGGAGTCATCTACTGAATGCTGCTCGGGGCTACATG
GAA
CAAGACGTCTACAACATCCTACTTCGAATCCTCAGCATGCAGGAGTGA


Translation (996 aa):
MKRIFSCSSSQVAVEKWNRRDQKLLEAVQRGDVGRVAALASRKSARPTKLDSNGQSPFHLAASKGLTECL
T
ILLANGADINSKNED
GSTALHLATISCQPQCVKVLLQHGANEDAVDAENRSPLHWAASSGCASSVLLLC
D
HEAFLDVLDN
DGRTPLMIASLGGHAAICSQLLQRGARVNVTDKDDKSALILACEKGSAEVAELLLSHGA
D
AGAVDSLGHNALHYALRTQDKELWRLLQQALNRRRRG
GHGLVQHPDHPSQASSCEPRVGSPPKNSRKVE
P
EEEQEEEGEERCSEEWRWKFEEEQRKVHQLEQELVRKTDECKAHAAAFSSLEEQIREQAQELGHLLVQE
P
GAPGNQGPGLRPEGDGMEEGCPLNLLAERIQELKKQQKALATINPTLVPKRAEELAPAEIHHEVHRKSQ
P
EQGLPQGPSSETTGKATGQQPNTNGGQNLGLQNTEQVCAGQKERTPAPGTETAGTVGEPVGIAMNQLLL
Q
LREELAAVWREKDAARGALSRPVLEGALGTPRAEAAAAAWEKMEARLERVLVRLDGAKMGLHVKPEVPV
Q
GSRDGAPKAVPGCSKEQEEKKALGTRGEPLGAPGKEQALGGGLAKGQLEKEVSALRLSNSNLLEELGEL
G
RERQRLQGELQSLTQRLHREFVPKPEAQVQLQQLRRSVGMLTEELAMEKEATDKLRRLLASQTSGLQGL
W
KCLPPDLVGKGNTQSTAAEPLEELQACISTLVDRHLEAQRVLARLEEENQQLRGSLAPCGEPEASLKVT
A
SPQVAALEEDLGMLEEELRAVQATMSGKSQEICKLKQLLYQATEEVAELRAREAASLRQHEKTRGSLVA
Q
AQAWGQELKVVLEKYNTACREMTRLRDTVAEERRRSEDLAARAAEQERQAGEMRGRSEQFEKTAELLKE
K
TNHLIGACRDKEAK
IKELLKKLEQLSEEVLEVRGENAHLALQLQDSQKNHEEIISTYRSHLLNAARGYM
E
QDVYNILLRILSMQE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser