NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS38409.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38409.1 Public Mus musculus 3 Pik3ca 23 108 98 CCDS HistoryNCBI Gene:18706Re-query CCDS DB by CCDS ID:38409.1Re-query CCDS DB by GeneID:18706See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38409.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000029201.13 ENSMUSP00000029201.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029201.13Link to Ensembl Protein Viewer:ENSMUSP00000029201.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000029201Re-query CCDS DB by Protein ID:ENSMUSP00000029201
Original member Current member EBI ENSMUST00000108243.7 ENSMUSP00000103878.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108243.7Link to Ensembl Protein Viewer:ENSMUSP00000103878.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108243Re-query CCDS DB by Protein ID:ENSMUSP00000103878
Original member NCBI NM_008839.2 NP_032865.2 Updated not alive Link to Nucleotide Sequence:NM_008839.2Link to Protein Sequence:NP_032865.2Re-query CCDS DB by Nucleotide ID:NM_008839Re-query CCDS DB by Protein ID:NP_032865
Current member NCBI NM_008839.3 NP_032865.2 Accepted alive Link to Nucleotide Sequence:NM_008839.3Link to Protein Sequence:NP_032865.2Re-query CCDS DB by Nucleotide ID:NM_008839Re-query CCDS DB by Protein ID:NP_032865Link to BLAST:NP_032865.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032865.2 1068 P42337 1068 100% 0 0

Chromosomal Locations for CCDS 38409.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 32436206 32436557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32437118 32437327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32437817 32438067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32439704 32439949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32440627 32440712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32442726 32442831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32443579 32443731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32443815 32443949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32447955 32448079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32449523 32449604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32449909 32450073 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32450262 32450365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32451756 32451927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32453861 32453967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32454379 32454500 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32456093 32456171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32459862 32460032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32461480 32461597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32461697 32461848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 32462561 32462831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3207 nt):
ATGCCTCCACGACCATCTTCGGGTGAACTGTGGGGCATCCACTTGATGCCCCCACGAATCCTAGTGGAAT
GT
TTACTCCCCAATGGAATGATAGTGACTTTAGAATGCCTCCGTGAGGCCACACTCGTCACCATCAAACA
T
GAACTGTTCAGAGAGGCCAGGAAATACCCTCTCCATCAGCTTCTGCAAGACGAAACTTCTTACATTTTC
GTA
AGTGTCACCCAAGAAGCAGAAAGGGAAGAATTTTTTGATGAAACAAGACGACTTTGTGACCTTCGGC
TT
TTTCAACCCTTTTTAAAAGTTATTGAACCAGTAGGCAACCGTGAAGAAAAGATCCTCAATCGAGAAAT
T
GGTTTTGTTATTGGCATGCCAGTGTGTGAATTTGATATGGTTAAAGATCCAGAAGTCCAAGACTTTCGA
AGG
AACATTCTGAATGTTTGCAAAGAAGCTGTGGACCTGCGGGATCTCAACTCGCCTCATAGCAGAGCAA
TG
TATGTCTACCCTCCAAATGTCGAGTCTTCCCCAGAACTGCCAAAGCACATCTACAACAAGTTAGATAA
A
GGACAAATCATAGTGGTGATTTGGGTAATAGTCTCTCCAAACAACGACAAGCAGAAGTACACTCTGAAG
ATC
AATCATGACTGTGTGCCAGAGCAAGTCATTGCTGAAGCCATCAGGAAAAAGACTCGGAGCATGTTGT
TG
TCCTCTGAGCAGCTGAAACTCTGTGTCTTAGAATATCAGGGCAAGTATATTCTGAAAGTGTGTGGCTG
T
GACGAATACTTCCTGGAAAAGTACCCTCTGAGTCAGTACAAGTACATAAGAAGCTGTATAATGCTGGGG
AGG
ATGCCCAACTTGATGCTGATGGCCAAAGAAAGCCTATACTCTCAGCTGCCGATTGATAGCTTCACCA
TG
CCGTCATACTCCAGGCGCATCTCCACAGCCACACCCTACATGAATGGAGAGACATCTACGAAATCCCT
C
TGGGTCATAAATAGTGCGCTCAGAATAAAAATTCTTTGTGCAACCTATGTAAATGTAAATATTCGAGAC
ATT
GATAAGATCTATGTTCGAACAGGTATCTACCATGGAGGAGAACCCTTATGTGACAATGTGAACACTC
AA
AGAGTACCTTGTTCCAATCCTAGGTGGAATGAATGGCTGAATTATGATATATACATTCCTGATCTTCC
T
CGTGCTGCGCGCCTTTGCCTTTCAATCTGCTCTGTTAAAGGCCGAAAGGGTGCTAAGGAGGAGCACTGT
CCG
TTGGCCTGGGGAAACATAAACTTGTTTGATTATACAGACACCCTAGTGTCCGGGAAAATGGCTTTGA
AT
CTCTGGCCTGTACCGCATGGGTTAGAAGATCTGCTGAACCCTATTGGTGTTACTGGGTCAAATCCAAA
T
AAAGAAACTCCATGCTTAGAGTTGGAGTTTGATTGGTTCAGCAGTGTGGTGAAGTTTCCAGACATGTCT
GTG
ATCGAAGAACATGCCAATTGGTCCGTGTCCCGAGAAGCTGGATTCAGTTACTCCCATACAGGACTGA
GT
AACAGACTAGCCAGAGACAATGAGTTAAGAGAAAATGACAAGGAACAGCTCCGAGCACTTTGCACCCG
G
GACCCACTATCTGAAATCACTGAACAAGAGAAAGACTTCCTATGGAGCCACAGACACTACTGCGTAACT
ATT
CCTGAAATCCTACCCAAATTGCTTCTGTCTGTCAAGTGGAATTCCAGAGACGAAGTGGCCCAGATGT
AC
TGCTTAGTAAAAGATTGGCCTCCAATCAAACCAGAGCAAGCCATGGAACTCCTGGACTGTAACTATCC
A
GATCCTATGGTTCGGAGTTTTGCTGTTCGGTGCTTAGAAAAATATTTAACAGATGACAAACTTTCTCAG
TAC
CTCATTCAACTTGTACAGGTCTTAAAATATGAACAGTATTTGGATAACCTGCTTGTGAGATTTTTAC
TC
AAGAAAGCATTGACAAATCAAAGGATTGGCCATTTTTTCTTTTGGCATTTAAAATCTGAGATGCACAA
T
AAGACTGTCAGTCAGAGGTTTGGCCTGCTATTGGAGTCCTACTGCCGTGCCTGTGGGATGTATCTGAAG
CAC
CTGAACAGACAAGTAGAGGCCATGGAGAAGCTCATCAACCTAACGGACATCCTTAAGCAGGAGAAGA
AG
GATGAGACACAAAAGGTACAGATGAAGTTTTTGGTTGAACAGATGAGACAGCCAGACTTCATGGATGC
T
TTGCAGGGTTTTCTGTCCCCTCTGAATCCTGCTCACCAACTAGGAAACCTCAGGCTTGAAGAGTGTCGA
ATT
ATGTCCTCTGCAAAAAGGCCACTGTGGTTGAATTGGGAGAACCCAGACATCATGTCAGAGCTACTGT
TT
CAGAACAATGAGATCATCTTTAAAAATGGCGACGACTTACGGCAAGATATGTTAACCCTTCAGATCAT
C
CGAATCATGGAGAACATCTGGCAAAACCAAGGCCTTGACCTTCGCATGCTACCTTATGGCTGTCTATCC
ATT
GGGGACTGTGTGGGTCTCATCGAGGTGGTGAGAAACTCTCACACCATCATGCAAATCCAGTGCAAAG
GA
GGCCTGAAGGGGGCGCTGCAGTTCAACAGCCACACACTGCATCAATGGCTCAAGGACAAGAACAAGGG
C
GAGATATATGATGCAGCCATTGACCTGTTCACTCGGTCCTGCGCTGGGTACTGCGTGGCAACCTTTATC
TTG
GGAATTGGAGACCGGCACAACAGCAACATCATGGTGAAAGATGACGGACAGCTGTTTCATATAGATT
TT
GGGCACTTTTTGGATCACAAGAAGAAAAAATTTGGCTATAAGCGGGAACGTGTGCCATTTGTGTTGAC
A
CAGGATTTCTTGATTGTGATTAGTAAGGGAGCACAAGAGTACACCAAGACCAGAGAGTTTGAGAGGTTT
CAG
GAGATGTGTTACAAGGCTTACCTAGCAATTCGGCAGCATGCCAATCTCTTCATCAACCTTTTTTCAA
TG
ATGCTTGGCTCTGGAATGCCAGAACTACAATCTTTTGATGACATTGCATATATCCGAAAGACTCTAGC
C
TTGGACAAAACTGAGCAAGAAGCTTTGGAATATTTCACAAAGCAAATGAATGATGCACATCATGGTGGA
TGG
ACGACAAAAATGGATTGGATCTTCCACACCATCAAGCAGCATGCTTTGAACTGA


Translation (1068 aa):
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFREARKYPLHQLLQDETSYIF
V
SVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREI
GFVIGMPVCEFDMVKDPEVQDFR
R
NILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDK
GQIIVVIWVIVSPNNDKQKYTLK
I
NHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYK
YIRSCIMLG
R
MPNLMLMAKESLYSQLPIDSFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRD
I
DK
IYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
P
LAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNK
ETPCLELEFDWFSSVVKFPDMS
V
IEEHANWSVSREAGFSYSHTGL
SNRLARDNELRENDKEQLRALCTRDPLSEITEQEKDFLWSHRHYCVT
I
PEILPKLLLSVKWNSRDEVAQ
MYCLVKDWPPIKPEQAMELLDCNYPDPMVRSFAVRCLEKYLTDDKLSQ
Y
LIQLVQ
VLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLK
H
LNRQVEAMEKLINLTDILKQEKKDETQK
VQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECR
I
MSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGD
DLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
I
GDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGE
IYDAAIDLFTRSCAGYCVATFI
L
GIGDRHNSNIMVKDDGQ
LFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQEYTKTREFERF
Q
EMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFTKQMNDAHHGG
W
TTKMDWIFHTIKQHALN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser