NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38200.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38200.1 Public Mus musculus 2 Thbs1 21 106 86 CCDS HistoryNCBI Gene:21825Re-query CCDS DB by CCDS ID:38200.1Re-query CCDS DB by GeneID:21825See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38200.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000039559 ENSMUSP00000044903 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000039559Link to Ensembl Protein Viewer:ENSMUSP00000044903Re-query CCDS DB by Nucleotide ID:ENSMUST00000039559Re-query CCDS DB by Protein ID:ENSMUSP00000044903
Original member Current member EBI,WTSI OTTMUST00000036100 OTTMUSP00000016220 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000036100Link to Vega Protein Viewer:OTTMUSP00000016220Re-query CCDS DB by Nucleotide ID:OTTMUST00000036100Re-query CCDS DB by Protein ID:OTTMUSP00000016220
Original member Current member NCBI NM_011580.4 NP_035710.2 Accepted alive Link to Nucleotide Sequence:NM_011580.4Link to Protein Sequence:NP_035710.2Re-query CCDS DB by Nucleotide ID:NM_011580Re-query CCDS DB by Protein ID:NP_035710Link to BLAST:NP_035710.2

Chromosomal Locations for CCDS 38200.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 118112643 118112709 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118112970 118113529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118114334 118114409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118114651 118114853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118114948 118115070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118115830 118115923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118117484 118117657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118118162 118118338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118118649 118118822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118119079 118119206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118119322 118119474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118119817 118120035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118120222 118120329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118120836 118120995 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118121117 118121235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118122446 118122680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118122874 118123101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118123268 118123539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118123916 118124013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118124120 118124259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 118125022 118125029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3516 nt):
ATGGAGCTCCTGCGGGGACTAGGTGTCCTGTTCCTGTTGCATATGTGTGGAAGCAACCGCATTCCAGAGT
CT
GGGGGAGATAACGGTGTGTTTGACATCTTTGAACTCATTGGAGGTGCACGAAGGGGCCCCGGTCGCCG
A
CTGGTGAAGGGCCAAGATCTATCCAGCCCCGCCTTCCGCATTGAGAATGCCAACCTGATCCCCGCTGTG
CCG
GATGACAAGTTCCAAGACCTACTGGACGCTGTGTGGGCCGACAAAGGCTTCATCTTCCTGGCTTCCT
TG
AGGCAGATGAAGAAGACCCGGGGCACACTCCTGGCTGTGGAACGGAAAGACAACACTGGCCAGATCTT
C
AGTGTGGTCTCCAACGGCAAAGCTGGCACCCTGGACCTGAGCCTGAGCCTGCCAGGGAAGCAACAAGTG
GTG
TCAGTGGAGGAAGCTCTCCTGGCCACTGGCCAGTGGAAGAGCATCACGCTGTTTGTTCAAGAGGACC
GG
GCTCAACTCTACATAGACTGTGATAAGATGGAGAGCGCGGAGCTGGATGTACCCATCCAGAGCATCTT
C
ACCAGGGATCTGGCCAGCGTTGCCAGGCTCCGAGTTGCAAAGGGAGATGTCAATGACAATTTTCAGGGG
GTG
CTGCAGAATGTGAGGTTTGTCTTTGGAACCACCCCAGAAGACATTCTCAGGAACAAAGGCTGCTCCA
GC
TCAGCTACCAACGTCCTTCTTACCCTTGACAACAACGTGGTGAACGGTTCCAGCCCTGCTATCCGCAC
C
AACTACATCGGCCACAAAACAAAGGACCTCCAAGCTATCTGTGGCCTCTCCTGTGATGAACTATCCAGC
ATG
GTCCTGGAACTGAAGGGCCTGCGCACCATCGTGACCACTCTGCAGGACAGCATCCGAAAAGTGACGG
AA
GAGAACAGAGAGCTGGTCAGTGAGCTGAAGCGGCCTCCCCTCTGCTTTCACAATGGAGTCCAGTACAA
G
AACAACGAGGAGTGGACTGTAGACAGTTGCACAGAGTGTCACTGCCAGAACTCGGTTACCATCTGCAAA
AAG
GTGTCCTGTCCCATCATGCCCTGCTCCAACGCCACAGTTCCTGATGGTGAATGCTGCCCACGGTGCT
GG
CCCAGCGACTCTGCTGACGATGGCTGGTCTCCCTGGTCTGAGTGGACCTCCTGCTCTGCCACATGTGG
C
AATGGAATTCAGCAACGTGGTCGTTCCTGTGACAGCCTCAACAACAGATGCGAGGGCTCTTCGGTACAG
ACA
AGGACCTGCCACATTCAGGAGTGTGACAAAAGATTTAAACAGGATGGTGGCTGGAGTCACTGGTCTC
CA
TGGTCGTCCTGTTCTGTGACCTGTGGTGACGGTGTGATCACAAGGATCCGGCTCTGCAACTCCCCCAG
C
CCCCAGATGAACGGGAAGCCCTGTGAAGGTGAAGCCCGGGAGACCAAAGCCTGCAAGAAAGACGCCTGC
CCA
ATTAATGGAGGCTGGGGTCCCTGGTCACCATGGGACATCTGCTCTGTCACCTGTGGAGGAGGAGTGC
AG
AGACGCAGCCGACTCTGTAACAACCCCACACCCCAGTTTGGAGGCAAAGACTGTGTTGGCGATGTGAC
A
GAAAATCAAGTTTGCAACAAGCAGGACTGCCCAATTGATGGATGCCTGTCCAATCCCTGCTTTGCTGGT
GCC
AAGTGTACTAGCTACCCTGATGGTAGCTGGAAATGTGGTGCGTGTCCTCCTGGCTACAGTGGAAATG
GC
ATCCAGTGCAAAGACGTCGATGAGTGCAAAGAAGTGCCTGATGCTTGCTTCAATCACAACGGAGAACA
T
CGGTGCAAGAACACAGATCCTGGCTACAACTGCCTGCCCTGCCCACCACGATTCACTGGCTCACAGCCC
TTC
GGCCGAGGTGTCGAACATGCCATGGCCAACAAACAGGTGTGCAAACCGCGAAACCCCTGCACGGACG
GG
ACGCATGACTGCAACAAGAACGCTAAGTGCAACTACCTGGGTCACTACAGTGACCCCATGTACCGCTG
T
GAGTGCAAGCCCGGCTATGCAGGCAATGGCATCATCTGCGGAGAGGACACAGACCTGGACGGCTGGCCT
AAT
GAAAACCTGGTGTGTGTGGCCAACGCAACCTACCACTGCAAAAAGGACAACTGCCCCAACCTTCCCA
AC
TCGGGGCAGGAAGACTATGACAAGGACGGGATTGGCGATGCCTGCGATGATGACGATGACAACGACAA
G
ATCCCCGATGACAGGGACAACTGTCCATTCCATTACAACCCAGCCCAGTATGACTATGACAGAGATGAT
GTG
GGAGACCGCTGTGACAACTGCCCCTACAACCACAACCCTGACCAAGCAGACACAGACAAAAACGGGG
AG
GGCGATGCCTGTGCTGTGGACATCGATGGAGATGGAATCCTCAATGAACGAGACAACTGCCAGTACGT
T
TACAACGTGGACCAGAGGGACACGGACATGGATGGGGTTGGAGATCAGTGTGACAACTGCCCCCTGGAA
CAC
AATCCAGACCAGCTGGACTCTGACTCAGACCTCATAGGGGACACTTGTGACAACAATCAGGACATCG
AT
GAGGATGGCCATCAGAACAATCTGGACAACTGTCCCTATGTGCCTAATGCCAACCAGGCCGACCATGA
T
AAAGATGGCAAAGGAGATGCCTGTGACCATGACGATGACAATGACGGCATCCCTGATGACAGAGACAAC
TGC
AGGCTGGTGCCCAATCCTGACCAGAAGGACTCTGATGGTGATGGCCGAGGTGACGCCTGCAAAGACG
AC
TTTGACCATGACAATGTGCCAGATATTGATGACATCTGTCCTGAGAATTTTGACATCAGTGAAACCGA
T
TTCCGACAATTCCAGATGATTCCTCTAGATCCCAAAGGAACCTCCCAAAATGACCCTAACTGGGTTGTC
CGC
CATCAGGGCAAAGAACTTGTCCAGACTGTAAACTGTGACCCTGGACTTGCTGTAGGTTATGATGAGT
TT
AATGCTGTGGACTTCAGCGGTACCTTCTTCATCAACACCGAGAGAGATGATGACTACGCTGGCTTTGT
T
TTCGGCTACCAGTCCAGCAGCCGCTTCTACGTTGTGATGTGGAAACAAGTCACCCAGTCCTACTGGGAC
ACC
AACCCCACAAGGGCTCAGGGATACTCAGGCCTGTCTGTAAAGGTTGTGAACTCCACCACCGGCCCTG
GC
GAGCACCTGCGGAATGCACTGTGGCACACAGGAAACACCCCTGGCCAGGTGCGCACCCTGTGGCATGA
C
CCTCGCCACATCGGCTGGAAAGATTTCACTGCATACAGATGGCGTCTCAGCCACAGGCCAAAGACCGGT
TAT
ATCAGAGTGGTGATGTATGAAGGAAAGAAAATCATGGCTGACTCGGGACCCATCTATGACAAAACCT
AC
GCCGGCGGTAGACTAGGCCTGTTCGTCTTCTCTCAGGAAATGGTGTTCTTCTCAGACATGAAATACGA
G
TGTCGAGATTCCTAA


Translation (1171 aa):
MELLRGLGVLFLLHMCGSNRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFRIENANLIPAV
P
DDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFSVVSNGKAGTLDLSLSLPGKQQV
V
SVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELDVPIQSIFTRDLASVARLRVAKGDVNDNFQ
G
V
LQNVRFVFGTTPEDILRNKGCSS
SATNVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSS
M
VLELKGLRTIVTTLQDSIRKV
TEENRELVSELKRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICK
K
VSCPIMPCSNATVPDGECCPRCW
PSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQ
T
RTCHIQECDKR
FKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDAC
P
INGGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQVCNKQDCPIDGCLSNPCFAG
A
KCTSYPDGSWKCGACPPGYSGNGIQCKDVDE
CKEVPDACFNHNGEHRCKNTDPGYNCLPCPPRFTGSQP
F
GRGVEHAMANKQ
VCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWP
N
ENLVCVANATYHCKK
DNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDD
V
GDRCDNCPYNHNPDQADTDKNGEGDACAVDIDGD
GILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLE
H
NPDQ
LDSDSDLIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDRDN
C
RLVPNPDQKDSD
GDGRGDACKDDFDHDNVPDIDDICPENFDISETDFRQFQMIPLDPKGTSQNDPNWVV
R
HQGKELVQTVNCDPGLAV
GYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWD
T
NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQ
VRTLWHDPRHIGWKDFTAYRWRLSHRPKTG
Y
I
RVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDMKYECRDS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser