NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38183.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38183.1 Public Mus musculus 2 Accsl 23 108 98 CCDS HistoryNCBI Gene:381411Re-query CCDS DB by CCDS ID:38183.1Re-query CCDS DB by GeneID:381411See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38183.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000099690.3 ENSMUSP00000097281.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000099690.3Link to Ensembl Protein Viewer:ENSMUSP00000097281.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000099690Re-query CCDS DB by Protein ID:ENSMUSP00000097281
Original member Current member NCBI NM_001033452.4 NP_001028624.2 Accepted alive Link to Nucleotide Sequence:NM_001033452.4Link to Protein Sequence:NP_001028624.2Re-query CCDS DB by Nucleotide ID:NM_001033452Re-query CCDS DB by Protein ID:NP_001028624Link to BLAST:NP_001028624.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028624.2 580 Q3UX83-1 580 100% 0 0

Chromosomal Locations for CCDS 38183.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 93855728 93855780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93856697 93856850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93856945 93857087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93857895 93858036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93858137 93858182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93859356 93859445 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93861017 93861117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93861469 93861546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93861774 93861871 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93862791 93862857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93863100 93863169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93863919 93863989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93864392 93864451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93865682 93866229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 93869022 93869043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1743 nt):
ATGAGTGAGAACAGAAATGAAGGCTCCAGCCAGGCTGCCAAGGCTAATAGTGATACCCAGACTCCAAGTC
AC
TTCAAAGTCACCCACCCCAGACTCAGGGATCAGCTGAAGAAGAAGTCCTCCAAAAAGAAGGGCTTCAA
A
TTTGTGCAGGAGAAGATGTTGAAGTTTCAGCATGTCATCAGGAATCAGTTCTTGCAGCAGATAAGCCAG
CAG
ATGCAGTGCGTCCCGCCGGGAGATCAGCAATGCACACAAACCTCCAGGAAGCGGAAAAAGATGGGCT
AC
CTACTGTCTCAGATGGTCAACTTCTTATGGTCTAACACTGTAAAGAAACTGAAGTTCAAAGTACCTCT
C
CCTTGCTTGGACTCTAGATGTGGCATCAAAGTTGGGCACCAGACCCTGTCACCTTGGCAGACTGGCCAA
TCC
AGGCCTAGTCTGGGTGGCTTTGAGGCTGCCCTTGCCAGCTGCACCCTATCTAAGCGTGGGGCTGGCA
TC
TATGAGTCTTACCACTTAAGCTTCCAGAGCTACGAGGCCTATCAGGCTGACAAATACCACAAGGATAA
G
AACCCTTCGGGCTACATCAACCTTAGTACCAGCGAGAACAAGCTTTGCCTTGACCTGATAACAGCGAGG
TTG
ACTCAGAGTGACATGAACTTACTTGATGAGGCCCAGCTGCAGTACTCCGACTGGAAAGGACAACCCT
T
C
CTTCGGGAAGAGCTGGCTAGCTTCTTGACCCACTACTGCAAGGCGCCTACACCCCTTGACCCAGAAAA
T
GTGGTGGTTCTAAATGGCTGCTCCTCAGTCTTTGCTTCACTGGCCATGGTTCTGTGTGACCCAGGTGAT
GCC
CTTCTGATCCCCACACCGTGCTACAATGGCTTTGTCTTCAGCTCCCACCTCTATTCCAAAATCGAGC
TT
ATTCCTGTCCACTTGGAGAGCCAGGTCCCCAGATCCAACTTGGATTCTTTCCAACTCACTGTGGATAA
G
CTCAAGCTTGCCCTGACTCAGGCTAAGAAGAAGGCAAAAAAGGTCAAAGGCCTTGTGCTCATCAACCCC
CAG
AATCCTCTGGGTGATGTCTACACTCAGTCGTCACTGCAAGAATACCTGGTCTTTGCTAAGACTCACA
AG
CTGCACGTGATCATGGACGAGATTTACATGCTGTCAGTGTTTGAGCCGTCTGTCACATTTCACAGCGT
T
CTGAGCATAAAAGACTTGCCTGACCCTAACATGACCCATATGATCTGGGGCACTAGTAAGGATTTCGGC
ATG
TCTGGCATCCGCTTTGGTGTTCTCTATACACACAACAAGGAGGTAGCCTCTGCCATGAAAGCTTTTG
GC
TACCACCATGGGGTCTCTGGCATTACTCAGTACAAGCTGTGCCGACTGCTCCAGGACAAAGAGTGGAT
C
AGTAAGGTGTACCTTCCTAAAAACCATAGCCGGCTCCAGAAGGCTTACAGCTATATCACTAAGATCCTG
AAG
GACTTGAAGATCCCCTTTTACAACGGTGGCTCTGGCCTCTTTGTCTGGATCAACTTGAAAGCTTATC
TG
AGTCCATGCACATTTGACCAAGAGCAGATCCTTCACCAGCGCTTCCGGGACAAGAAGCTGTTATTATC
T
AGTGGCAAATCCTACATGTGTATAGAGCCTGGCTGGTTCCGACTCGTCTTTGCAGAAACCCACCTTCAC
CTA
CAAGTGGCCATGGATCGGTTCTGCCACGTGCTTGCTGAACACAAAAAGCATGAAAAGTAA


Translation (580 aa):
MSENRNEGSSQAAKANSDTQTPSHFKVTHPRLRDQLKKKSSKKKGFKFVQEKMLKFQHVIRNQFLQQISQ
Q
MQCVPPGDQQCTQTSRKRKKMGYLLSQMVNFLWSNTVKKLKFKVPLPCLDSRCGIKVGHQTLSPWQTGQ
S
RPSLGGFEAALASCTLSKRGAGIYESYHLSFQSYEAYQADKYHKDKNPS
GYINLSTSENKLCLDLITAR
L
TQSDMNLLDEAQLQYSDWKGQP
FLREELASFLTHYCKAPTPLDPENVVVLNGCSSVFASLAMVLCDPGD
A
LLIPTPCYNGFVFSSHLYSKIELIPVHLESQ
VPRSNLDSFQLTVDKLKLALTQAKKKAKKVKGLVLINP
Q
NPLGDVYTQSSLQEYLVFAK
THKLHVIMDEIYMLSVFEPSVTFHSVLSIKDLPDPNMTHMIWGTSKDFG
M
SGIRFGVLYTHNKEVASAMKAFGYHHGVSGITQYKLCRLLQDK
EWISKVYLPKNHSRLQKAYSYITKIL
K
DLKIPFYNGGSGLFVWINLKA
YLSPCTFDQEQILHQRFRDKKLLLSSGKSYMCIEPGWFRLVFAETHLH
L
QV
AMDRFCHVLAEHKKHEK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser