NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38160.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38160.1 Public Mus musculus 2 Zfp804a 21 106 86 CCDS HistoryNCBI Gene:241514Re-query CCDS DB by CCDS ID:38160.1Re-query CCDS DB by GeneID:241514See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38160.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000047527 ENSMUSP00000041941 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000047527Link to Ensembl Protein Viewer:ENSMUSP00000041941Re-query CCDS DB by Nucleotide ID:ENSMUST00000047527Re-query CCDS DB by Protein ID:ENSMUSP00000041941
Original member Current member EBI,WTSI OTTMUST00000032239 OTTMUSP00000014329 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000032239Link to Vega Protein Viewer:OTTMUSP00000014329Re-query CCDS DB by Nucleotide ID:OTTMUST00000032239Re-query CCDS DB by Protein ID:OTTMUSP00000014329
Original member Current member NCBI NM_175513.3 NP_780722.2 Accepted alive Link to Nucleotide Sequence:NM_175513.3Link to Protein Sequence:NP_780722.2Re-query CCDS DB by Nucleotide ID:NM_175513Re-query CCDS DB by Protein ID:NP_780722Link to BLAST:NP_780722.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780722.2 1200 A2AKY4 1200 100% 0 0

Chromosomal Locations for CCDS 38160.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 82053791 82053901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 82235798 82235941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 82253461 82253591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 82256215 82259431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3603 nt):
ATGGAGTGTTACTACATTGTCATCAGCTCCACGCATCTCAGCAACGGACACTTTCGCAACATCAAGGGAG
TT
TTCCGGGGCCCTCTCAGCAAGAACGGGAACAAAACTCTGGACTATGCTGAAAAGGAGAACACTATTGC
C
AAAGCTCTGGAGGATCTGAAGGCAAATTTTTACTGTGAGCTTTGTGACAAGCAGTATTATAAGCATCAG
GAA
TTTGACAATCACATTAACTCATATGACCACGCCCACAAACAGAGGCTCAAAGAACTGAAACAGAGAG
AA
TTTGCTCGAAATGTAGCATCTAAATCCAGGAAGGATGAAAGAAAACAGGAAAAGGCACTCCAACGTCT
T
CACAAGCTGGCCGAGCTAAGAAAGGAAACTGTGTGTGCTCCTGGAAGTGGCCCCATGTTCAAGTCAACG
ACT
GTTACCGTGAGAGAAAATCTCAATGATGTTTCCCAAAGGGAGAGTGTAGATCCAATTAACAACCAGC
AA
GATTTGATTCCTAGTGAAGAGAAAGAGAGAGATGGCACTACAGCTCTGGCAGAAACAGAAACTGCGAG
T
AACTGCACAGCAAATAATTGCCAGATTGGGGATCAAAGCCAGGCTGTCCACAGACACAGAATTGGCTTC
TCC
TTTGCATTTCCAAAGAAAGCCACGGTGAAGCTAGAATCCTGCTCAGCTGCAGCCTTCTCGGAATACA
GC
GATGAATCCTCTATGGAGAAAGAATTTAGCAGGAAAACTAGATTTGTCCCCAGCACTTCTCATCTTCA
A
CTACCACCACCAACATGTGAGCTTCTGAGCTCTGAGGAGAAAGGTAACTCTCCTCCACCCGAGGCCATG
TGT
ACTGACAAAGCAACTGCTCAAACTGAAGAGAGGAAAATCACTTCTAATGAAAACAACACACTGTTAA
CT
TCTTCGTTTTGCCAGCTTCAACATTACATCCCTACATGTTCTGAGGCAGATACTTGCCAAAATTTGGC
A
CCATTTGAAGACCAATTACCAATGGAAGCAGTTATTGTGAATGAAGATGGACCTGTGAGTAAAAGCAAC
CCA
AATATCATAGAAAAGAATCCCACTGTGCCTAATGACCGCACATCAGCACAGATGACCACAGAGGAAA
AC
ATCACAATTAATGATGTGACCAAAATGGAAACTAGAAATAAAATTGATCATGAGCCACTGACACCTTC
A
AGTACTATAGAAGAAAGCATAAGGTTGCAAAAAAGGCCAGATCTATGTAAGAGACAATGTGACCCATTT
GTA
CCTGTACTTAACAAACTTGGATCCACAGTGCTTCAGTGGCCATCAGAAATGCTTGCTTATACAACTA
CA
GAGCCATCAATATCTTATAGCTGTAATCCACTCTGTTTTGACTTCAAGTCCACTAAATTAAACAACAA
T
CAAGATAAAAATAAGCTAACTTTAAATGACCTTTTCTCTGAACAGAAGGAGGACTGTTGTAAGGGAGCA
CAT
GCTGACTGCAAAGATGTTCCAATTGCAAGAGTAACAAATGATGAAACTGGCCATAGTAAAAATGATT
AC
CCTCAAGTTACTACACTTTCGCCTGTCCACGTTTTGTCTAATGGCTGTGATTTAGGACAAAATGAGAA
T
GTGGGTCAGAGGTATAAACATATTTCCTGTACAAACAGACAAACAAACAAATACAAATTTACTAGATGT
CAA
ATTAAACGAGACATGCTAAATGAGAAATACGACAAAATGAGGTTGAAGGAAACCCGTGAGCACTGGT
TC
CATAAAAGTAGAAGAAAGAAAAAGAGAAGAAAGTTATGTCGGTATCATCCTGGGAAGTCAAGCAAAGA
A
CCTGAAGGGTCTGGCAAAACAGAAAGGAGCAGACAACGCACTGATGAGGCCAGGAAGAATCCACGGGAG
CCA
GTTCTGGAAAAACATCCAAGGAGTCCAGAGAGAGCGTCAGACCTACACCAGCTGCCAGATGAAAGAC
CC
AAAGCAGCCTCTACACATTTAGGAGAAAAAGAAACAATGAACACAACAGTGAACACTGAATCCAATGA
T
GCTGCTCCTGGTTCTCAAAACTGTGGAGGAAAAAATGCAACAGTTGTAAATGAACAAGCAAAGCCACTA
GTG
ATACATTCTGTGAAACAAAATTTAACATATGTCAGAACTTACTGTTGTTGGAAAGCCAGAACATCCA
GA
TATCAAGAGGATGATGGGAGCTTGGCTTCTCAAAGTAATGTGAAAGGCCCAACTCAGAATCAGCCTGT
T
AAAAGAGGTTATAGTTCTCTCACAAATGACTCAGAAAGAATTCATCGGAAACGCAGACAGCATTCATGT
TCT
TACTCGTCAGATGAAAGTTTAAATCAACAACATCATTTAGGAGAATACTTGAAGCCACTAAGTACTT
CA
CTCATTTCCTGTCAGCCTAAGAAGAAACGAAGGAGAAAAAGAAGCCGACTCCACATTGGAGATGGAAC
T
ACGAAAATGAAAGGCAATTCAAATTATCCCATGAAGTGTAGTTCTTTGAGTCAACCAGATGAGTTAGCA
AAG
GACTGCATAAAAGAGGACATAAATCCACAAGAAAATGTAAGTATCGAGAAGAACTCAGAGCAAACAG
AG
CAAACAGAAATCAAAGGGATGCTCCATCCTTATAATCCACTTCTTTCTGAACCCAGTGGAGAAGGTGA
G
CATTCAGTAACAGAGACTACGCCATGTGACTCATCGCAGACTTCCAATGATCTTGCTACACCTGTGAAT
GTC
ACAAGGGACCCATCAAATAGCACCACTGACAATACCTTGCTTGAACACAATCAAAGAAGTCAGACTA
CA
AACAGTAACGAAAAACAAACTCCTTTCAAGGTGACTAATCCCGAAAGGAACTTTAGACACTCACAGGC
A
AAGTCGTACATTTGCCGATATGAGCTGGCCGAGACCATTCCACAGGGAAAGACGAATGAGGCATCAACA
GAG
TGGCTATGTTATAATTCAGGAATCCTTAACACACAACCACCATTGCAGTTCAAGGAAGCACACGTCA
GC
GGCCATGCTTTTGTTACAACAGAGCAAATCCTGGCTCCATTGCCTTTACCAGAGCAAGCTTTATTGAT
T
CCACTAGAAAACCACGACAAGTTAAAACATCTACCATGTGAGGTCTACCAGCACATCATTCAGCCGAAC
ATG
CTAACCAACAAGGTCAAATTTACCTTTCCTCCGCCTCCCCTGCCTCCTCCCAGCACTCCAGTGCAGC
CT
TTGCCTTTGCAGCGGCCCTTTTGTTCTACCTCTGTAACCACTATCCATCACACTGTTTTACAGCATCA
T
GCTGCAGCTGCGGCAGCAGCAGCTGCAGCTGCAGCTGCAGGAACCTTCAAAGTGCTTCAGCCACACCAA
CAG
TTCCTTCCCCAGGTCCCTGCTCTTGCCAGAACATCTATACCTCAGATCTCCGTAGGAACTGTAGGAC
CT
AGGCTTTGTCCTGGCGGTCAGCCAGCTTTGGTTGCTTCTCCTCAGATGCCAATCATCCCTGCATCCGT
T
CTTCACCCCAGCCCCTTGGCTTTTCCTCCCTTACCCCATTCATTCTTTCCCTCATTGCTTTCACCACAT
CCA
ACTGTCATTCCCCTCCAGCCCCTCTTCTAG


Translation (1200 aa):
MECYYIVISSTHLSNGHFRNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCELCDKQYYKHQ
E
FDNHINSYDHAHKQ
RLKELKQREFARNVASKSRKDERKQEKALQRLHKLAELRKETVCAPGSGPMFKST
T
VTVRENLNDVSQRESVDPINNQQDLIPSEEKERDGTTALAETETASNCTANNCQIGDQSQAVHRHRIGF
S
FAFPKKATVKLESCSAAAFSEYSDESSMEKEFSRKTRFVPSTSHLQLPPPTCELLSSEEKGNSPPPEAM
C
TDKATAQTEERKITSNENNTLLTSSFCQLQHYIPTCSEADTCQNLAPFEDQLPMEAVIVNEDGPVSKSN
P
NIIEKNPTVPNDRTSAQMTTEENITINDVTKMETRNKIDHEPLTPSSTIEESIRLQKRPDLCKRQCDPF
V
PVLNKLGSTVLQWPSEMLAYTTTEPSISYSCNPLCFDFKSTKLNNNQDKNKLTLNDLFSEQKEDCCKGA
H
ADCKDVPIARVTNDETGHSKNDYPQVTTLSPVHVLSNGCDLGQNENVGQRYKHISCTNRQTNKYKFTRC
Q
IKRDMLNEKYDKMRLKETREHWFHKSRRKKKRRKLCRYHPGKSSKEPEGSGKTERSRQRTDEARKNPRE
P
VLEKHPRSPERASDLHQLPDERPKAASTHLGEKETMNTTVNTESNDAAPGSQNCGGKNATVVNEQAKPL
V
IHSVKQNLTYVRTYCCWKARTSRYQEDDGSLASQSNVKGPTQNQPVKRGYSSLTNDSERIHRKRRQHSC
S
YSSDESLNQQHHLGEYLKPLSTSLISCQPKKKRRRKRSRLHIGDGTTKMKGNSNYPMKCSSLSQPDELA
K
DCIKEDINPQENVSIEKNSEQTEQTEIKGMLHPYNPLLSEPSGEGEHSVTETTPCDSSQTSNDLATPVN
V
TRDPSNSTTDNTLLEHNQRSQTTNSNEKQTPFKVTNPERNFRHSQAKSYICRYELAETIPQGKTNEAST
E
WLCYNSGILNTQPPLQFKEAHVSGHAFVTTEQILAPLPLPEQALLIPLENHDKLKHLPCEVYQHIIQPN
M
LTNKVKFTFPPPPLPPPSTPVQPLPLQRPFCSTSVTTIHHTVLQHHAAAAAAAAAAAAAGTFKVLQPHQ
Q
FLPQVPALARTSIPQISVGTVGPRLCPGGQPALVASPQMPIIPASVLHPSPLAFPPLPHSFFPSLLSPH
P
TVIPLQPLF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser