NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38076.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38076.1 Public Mus musculus 2 Rabl6 21 106 86 CCDS HistoryNCBI Gene:227624Re-query CCDS DB by CCDS ID:38076.1Re-query CCDS DB by GeneID:227624See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38076.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000058137 ENSMUSP00000058746 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058137Link to Ensembl Protein Viewer:ENSMUSP00000058746Re-query CCDS DB by Nucleotide ID:ENSMUST00000058137Re-query CCDS DB by Protein ID:ENSMUSP00000058746
Original member Current member EBI,WTSI OTTMUST00000029134 OTTMUSP00000013172 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000029134Link to Vega Protein Viewer:OTTMUSP00000013172Re-query CCDS DB by Nucleotide ID:OTTMUST00000029134Re-query CCDS DB by Protein ID:OTTMUSP00000013172
Original member NCBI NM_001024616.1 NP_001019787.2 Updated not alive Link to Nucleotide Sequence:NM_001024616.1Link to Protein Sequence:NP_001019787.2Re-query CCDS DB by Nucleotide ID:NM_001024616Re-query CCDS DB by Protein ID:NP_001019787
Current member NCBI NM_001024616.2 NP_001019787.2 Accepted alive Link to Nucleotide Sequence:NM_001024616.2Link to Protein Sequence:NP_001019787.2Re-query CCDS DB by Nucleotide ID:NM_001024616Re-query CCDS DB by Protein ID:NP_001019787Link to BLAST:NP_001019787.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001019787.2 725 Q5U3K5 725 100% 0 0

Chromosomal Locations for CCDS 38076.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 25583791 25583988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25584103 25584161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25584776 25584944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25585308 25585536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25585624 25585833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25586868 25587018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25587275 25587627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25588609 25588712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25592298 25592403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25592767 25592907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25596433 25596524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25598145 25598197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25601351 25601398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25602421 25602555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 25608113 25608242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2178 nt):
ATGTTCTCCGCGTTGAAGAAGCTGGTGGGGTCGGAGCAGGCCCCAGGCCGGGACAAGAACATCCCCGCCG
GG
CTGCAGTCCATGAACCAGGCGCTGCAGAGGCGCTTCGCTAAGGGGGTTCAGTATAACATGAAGATTGT
G
ATCCGGGGTGACAGGAACACGGGCAAGACAGCTCTGTGGCATCGACTGCAGGGCAAGAAGTTTGTGGAA
GAA
TACATCCCCACACAGGAGATCCAGGTCACCAGCATCCATTGGAACTACAAAACTACTGATGATGTAG
TG
AAAGTTGAAGTCTGGGATGTAGTTGACAAAGGAAAGTGTAAAAAACGAGGAGATGGCTTGAAGACGGA
A
AATGACCCCCAGGAGGCAGAGTCTGAATTGGCCCTGGATGCTGAGTTTCTGGATGTGTACAAGAACTGT
AAT
GGAGTGGTCATGATGTTTGACATCACTAAGCAGTGGACCTTCAATTATGTTCTCCGGGAGCTTCCCA
AA
GTGCCAACCCATGTGCCGGTGTGTGTGCTGGGCAACTACCGTGACATGGGCGAGCATCGAGTCATTCT
A
CCAGACGATGTGCGGGACTTCATTGAGCATCTGGACAGACCTCCAGGTTCCTCCTATTTCCGCTATGCT
GAA
TCTTCCATGAAGAACAGCTTTGGTCTAAAGTACCTGCATAAGTTCTTCAACATCCCATTTTTGCAAC
TA
CAGAGGGAGACACTACTGAGGCAGCTGGAGACAAACCAACTAGACATCGATGCCACACTAGAGGAGCT
A
TCAGTGCAGCAGGAAACCGAGGACCAGAACTACAGCATCTTCCTTGAAATGATGGAGGCTCGAAGTCGA
GGC
CACGCATCCCCTTTGGCAGCCAATGGGCAGAGCCCATCCTCAGGCTCCCAGTCGCCAGTTGTGCCTC
CA
AGTGCTGTATCCACAGGGAGTTCCAGCCCCAGCACACCCCAGCCTGCCCCTCAGCTGTCTCTAGGTGT
C
TCCTCCACCTGTCCCTCAGCACCATCTCCTGTACCCTCTTTGGAGGCCATGCCCTCCTCTGTACACTCT
TCA
GCCCCAGCCCCAACCCCAGCTCCAGCCCCAGCTCCAGCCCAGCGTCGCAGTATCATCTCTCGGCTGT
TT
GGGACCTCACCAGCTGCAGAAGTGACCCCTTCACCTCCAGAGCCAGCTCCAGCTCTCGAAGCTCCAGC
A
AGAGTCCAGAATGTTGAGGATTTTGTCCCTGAAGATGGCCTTGACCGAAGCTTCCTGGAAGACACAAGT
GTG
CCTAAAGACAAGAAAGTTGGAGCCAAAGGTCCCCAGCAGGATAGTGACAGTGACGATGGGGAGGCCC
TA
GGAGGGAACCCAATGGTGGCAGGTTTCCAGGATGATGTGGACATAGAAGACCAGACACATGGCAAATC
C
CTGCTGCCCTCGGATCCCATGCCCAGTAAGAACATCAGTCTCTCAAGTGAGGAGGAAGCCGAAGGACTG
GCA
GGCCACCCTAGAGTGGCCCCTCAGCAATGCTCAGAGCCTGAGACTAAATGGTCCTCCACCAAGGTCT
CA
CATCCACAAAAGAAGAGAGCTCCCACGAGAGGCACGCCACCGTGGTCAGATGGTCTCACCACTGATGA
C
TCTGAAAGACCCCAGGAAGGGAAGGACAAACAGGTGTCATCAGAGAGTGATCCTGAGGGGCCCATTGCT
GCC
CAGATGCTGTCCTTCGTCATGGATGACCCAGACTTTGAAAGTGATGAATCAGATACACAGAGGAGAA
TG
GGCAGGTTTCCAGTAAGAGAAGACCTCTCTGATGTAACTGATGAGGACACTGGCCCTGCTCAGCCACC
T
CCACCTTCCAAGCTCCCAGGTGCTTTCAGACTGAAGAATGACTCCGATCTCTTTGGGCTGGGCCTAGAG
GAG
ATGGGACCTAAGGAAAGCAGTGACGAAGATAGAGACAGCAAACTTCCCTCTAAGGAGAAGAAGAAAA
AG
AAGAAGAAAAGCAAAGAGGAGGAAGAAAAGACTACAAAAAAGAAAAGCAAACACAAGAAGAGCAAGGA
C
AAGGAGGAGGGCAAGGAGGATCGGAAGAAGAAGAGGAAGCCCCCTCGGAGCAAAGAGCAGAAGGCTGCA
GAT
GAGCTGGAAGCCTTCCTGGGGGGTGGGGCCCCTGGCAGCCGCCACCCTGGAGGTGGGGACTATGAGG
AG
CTCTAA


Translation (725 aa):
MFSALKKLVGSEQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGKKFVE
E
YIPTQEIQVTSIHWNYK
TTDDVVKVEVWDVVDKGKCKKRGDGLKTENDPQEAESELALDAEFLDVYKNC
N
GVVMMFDITKQ
WTFNYVLRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYFRYA
E
SSMKNSFGLKYLHKFFNIPFLQLQ
RETLLRQLETNQLDIDATLEELSVQQETEDQNYSIFLEMMEARSR
G
HASPLAANGQSPSSGSQSPVVPPSAVSTGSSSPSTPQPAPQLSLGVSSTCPSAPSPVPSLEAMPSSVHS
S
APAPTPAPAPAPAQRRSIISRLFGTSPAAEVTPSPP
EPAPALEAPARVQNVEDFVPEDGLDRSFLEDTS
V
PKDKKVGAKGPQQDSD
SDDGEALGGNPMVAGFQDDVDIEDQTHGKSLLPSDPMPSKNISLSSEEEAEGL
A
GHPRVAPQQCSEPETK
WSSTKVSHPQKKRAPTRGTPPWSDGLTTDDSERPQEGKDKQVSSESDPEGPIA
A
QMLSFVMDDPDFESDESDTQRRM
GRFPVREDLSDVTDEDTGPAQPPPPSKLPGAFRLKNDSDLFGLGLE
E
MGPKESSDE
DRDSKLPSKEKKKKKKKSKEEEEKTTKKKSKHKKSKDKEEGKEDRKKKRKPPRSKEQKAA
D
ELEAFLGGGAPGSRHPGGGDYEEL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser