NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38045.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38045.1 Public Mus musculus 2 Atp5c1 23 108 98 CCDS HistoryNCBI Gene:11949Re-query CCDS DB by CCDS ID:38045.1Re-query CCDS DB by GeneID:11949See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38045.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000114897.8 ENSMUSP00000110547.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114897.8Link to Ensembl Protein Viewer:ENSMUSP00000110547.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000114897Re-query CCDS DB by Protein ID:ENSMUSP00000110547
Original member Current member NCBI NM_020615.4 NP_065640.2 Accepted alive Link to Nucleotide Sequence:NM_020615.4Link to Protein Sequence:NP_065640.2Re-query CCDS DB by Nucleotide ID:NM_020615Re-query CCDS DB by Protein ID:NP_065640Link to BLAST:NP_065640.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065640.2 298 Q91VR2 298 100% 0 0

Chromosomal Locations for CCDS 38045.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 10056800 10056806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10058996 10059092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10059501 10059656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10063286 10063350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10063443 10063586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10064107 10064311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10068610 10068741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10069693 10069727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 10080348 10080403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (897 nt):
ATGTTCTCGCGGGCGAGCGTTGTCGGGCTGTCGGCCTGCGCCGTGCAGCCGCAATGGATCCAAGTTCGAA
AC
ATGGCAACTCTGAAAGATATTACCAGGAGACTGAAGTCCATCAAAAACATCCAGAAAATTACCAAGTC
T
ATGAAGATGGTGGCAGCTGCAAAGTATGCCCGGGCTGAGCGGGAGCTGAAGCCTGCCCGAGTGTATGGG
ACA
GGTTCTTTGGCTCTGTATGAGAAGGCTGATATTAAGGCACCTGAGGACAAGAAGAAGCACCTCATTA
TT
GGTGTGTCCTCAGATAGAGGGCTTTGTGGTGCTATTCACTCCTCAGTGGCTAAACAGATGAAGAATGA
A
GTGGCTGCCCTCACAGCAGCTGGGAAAGAAGTTATGATTGTTGGAGTTGGTGAAAAAATCAAGGGCATA
CTT
TATAGGACTCATTCTGATCAGTTTTTGGTGTCATTCAAAGATGTGGGACGGAAGCCTCCTACTTTTG
GA
GATGCATCAGTCATTGCCCTTGAGTTGTTAAATTCTGGATATGAATTTGATGAAGGCTCTATCATTTT
T
AATCAGTTCAAGTCTGTTATCTCCTACAAGACAGAAGAGAAGCCCATCTTCTCTCTGAATACCATTGCG
ACT
GCTGAGACCATGAGCATCTATGATGACATTGATGCTGATGTGCTGCAGAATTACCAGGAGTACAATC
TG
GCCAACCTCATCTACTACTCCCTGAAGGAGTCCACCACCAGTGAGCAGAGTGCCAGGATGACCGCCAT
G
GACAACGCCAGCAAGAACGCTTCTGATATGATTGACAAATTGACCTTGACTTTCAACCGCACCCGCCAG
GCT
GTCATCACAAAGGAGTTGATTGAAATCATCTCTGGGGCTGCTGCTCTGGATTAA


Translation (298 aa):
MFSRASVVGLSACAVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYG
T
GSL
ALYEKADIKAPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKNEVAALTAAGKEVMIVGVGEKIKGI
L
Y
RTHSDQFLVSFKDVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNQFKSVISYKTEEKPIFSLNTIA
T
A
ETMSIYDDIDADVLQNYQEYNLANLIYYSLKESTTSEQSARMTAMDNASKNASDMIDKLTLTFNRTRQ
A
VITKELIEIISGAAA
LD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser