NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38015.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38015.1 Public Mus musculus 19 Calhm1 21 106 86 CCDS HistoryNCBI Gene:546729Re-query CCDS DB by CCDS ID:38015.1Re-query CCDS DB by GeneID:546729See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 38015.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111813 ENSMUSP00000107444 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111813Link to Ensembl Protein Viewer:ENSMUSP00000107444Re-query CCDS DB by Nucleotide ID:ENSMUST00000111813Re-query CCDS DB by Protein ID:ENSMUSP00000107444
Original member Current member NCBI NM_001081271.1 NP_001074740.1 Accepted alive Link to Nucleotide Sequence:NM_001081271.1Link to Protein Sequence:NP_001074740.1Re-query CCDS DB by Nucleotide ID:NM_001081271Re-query CCDS DB by Protein ID:NP_001074740Link to BLAST:NP_001074740.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074740.1 348 D3Z291 348 100% 0 0

Chromosomal Locations for CCDS 38015.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 47141035 47141529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 47143623 47144174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1047 nt):
ATGGATAAGTTTCGGATGATCTTCCAGTTCTTGCAATCCAACCAAGAGTCCTTCATGAATGGCATCTGTG
GC
ATCATGGCGCTGGCCAGTGCGCAGATGTATTCTGCCTTTGACTTCAACTGCCCCTGCTTACCCGGCTA
C
AACGTGGTCTACAGCCTGGGCATACTGCTGACGCCTCCCCTGGTGCTCTTCCTGCTTGGTCTGGTCATG
AAC
AACAACATATCCATGCTAGCTGAAGAGTGGAAGCGCCCCGCAGGTCGCCGGGCCAAGGACCCAGCTG
TT
CTACGCTACATGTTCTGTTCCATGGCCCAGAGAGCTCTCATCGCCCCTGTCGTCTGGGTGGCTGTCAC
A
CTGCTGGATGGCAAGTGCTTTCTCTGTGCCTTCTGCACAGCTGTGCCCGTGGCCACACTAGGCAATGGC
AGC
CTGGTGCCGGGCCTGCCTGCTCCAGAACTTGCTCGCCTACTGGCTCGGGTACCCTGCCCTGAGATCT
AT
GATGGGAACTGGCTGCTAGCCCGAGAGGTGGCCGTGCGGTATTTGCGCTGCATCTCTCAGGCACTGGG
T
TGGTCCTTCGTGCTGCTGACCACATTACTAGCGTTCGTGGTACGCTCTGTGCGTCCCTGCTTCACGCAG
GTC
GCCTTTCTCAAGAGCAAGTACTGGTCCCACTACATTGACATTGAGCGCAAGCTCTTCGATGAGACAT
GC
ACAGAGCATGCCAAAGCCTTTGCTAAGGTATGTATCCAGCAGTTCTTTGAAGCCATGAACCATGACCT
G
GAACTGGGTCATACCCACGGAGTACTGGCCACGGCCACAGCCACAGCCACAGCCACAGAGGCTGTCCAA
AGT
CCCTCGGACAGGACAGAAGAAGAGAGGGAGAAGTTGCGTGGCATCACTGACCAAGGCACCATGAATA
GG
CTACTCACAAGCTGGCACAAATGCAAACCACCACTGAGGCTGGGCCAGGAGGCACCACTGATGAGCAA
C
GGCTGGGCTGGGGGCGAGCCCCGGCCTCCACGCAAGGAAGTGGCCACCTACTTCAGCAAAGTGTGA


Translation (348 aa):
MDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNVVYSLGILLTPPLVLFLLGLVM
N
NNISMLAEEWKRPAGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLLDGKCFLCAFCTAVPVATLGNG
S
LVPGLPAPELARLLARVPCPEIYDGNWLLAREVAVRYLRCISQ
ALGWSFVLLTTLLAFVVRSVRPCFTQ
V
AFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGVLATATATATATEAVQ
S
PSDRTEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEAPLMSNGWAGGEPRPPRKEVATYFSKV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser