NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37819.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37819.1 Public Mus musculus 18 Srfbp1 23 108 98 CCDS HistoryNCBI Gene:67222Re-query CCDS DB by CCDS ID:37819.1Re-query CCDS DB by GeneID:67222See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37819.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000025406.8 ENSMUSP00000025406.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025406.8Link to Ensembl Protein Viewer:ENSMUSP00000025406.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000025406Re-query CCDS DB by Protein ID:ENSMUSP00000025406
Original member Current member NCBI NM_026040.4 NP_080316.3 Accepted alive Link to Nucleotide Sequence:NM_026040.4Link to Protein Sequence:NP_080316.3Re-query CCDS DB by Nucleotide ID:NM_026040Re-query CCDS DB by Protein ID:NP_080316Link to BLAST:NP_080316.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080316.3 441 Q9CZ91 441 100% 0 0

Chromosomal Locations for CCDS 37819.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 52465720 52465785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 52475596 52475684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 52476300 52476372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 52483633 52483704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 52487512 52487593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 52488251 52488971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 52490018 52490055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 52490444 52490628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1326 nt):
ATGGCGGCTGACCCTCTTCCTCCGTCCGCAATGGTTCAGCCGGGGACTCTGAACCTCAATAACGAGGTTG
TA
AAGATGAGAAAAGAAGTGAAGCGAATCCGAGTTCTGGTCATCCGAAAACTTGTCAGGAGTGTCGGCAG
A
CTGAAGTCCAAAAAGGGCACAGAAGATGCACTGTTGAAAAACCAAAGGCGAGCCCAAAGGTTGCTTGAG
GAG
ATCCATGCCATGAAGGAATTGAAACCTGATGTTGTAACTAAATCTGCTCTTAGTGATGATATCAACT
TT
GAAAAAACTTGCAAAAAGCCGGATTCTACCGCGACCGACAGAGCGGTTGCCAGATTAGCAGGTCACCC
G
CTTCTGAAGAAGAAAATTGATGTGCTAAAAGATGCTGTCCAGGCCTTCAAAGATGCAAGGCAGAGTGCT
CCA
GCGGCCGAATCATCTGAGAGTACTTCAGGAGAAGGCCGGTGTAAGGACATTGCAAGGTCAAAGGATG
AT
GCACGTGAGTCACAGCATCCTGAGAGAACTGTTGTCAGGGAGCAGAAGGCAAAGGACACCAACACGGC
A
GCAAAGAATGCAGCAAGTGGTTCAAAAGAAAAACTGGCCAAGACAGAGCAGGCACCCAGAGCAGGGACC
ACT
CCAGGGTCTCAGGGGAGGCCTTCAGGAAAGGGTGCTGGGGTTAACTCTGAACACCAGGGGGCCCCAG
CC
CCAGGGGACAGCAACCAGGGGAAAGCCTCAACCAAAACCCCGGAGGACAGCGTGTGTGAACCTGCTAA
T
AACGGTGTCAGTGAGGAAGAGGAGAGCGAGGGGGAAAAGGAGTATTTTGATGACAGCACTGAAGAACGG
TTC
TACAAACAGTCTTCTGCATCTGAGGACAGCGACAGTGGTGACGACTTCTTCATTGGAAAAGTCAGAC
GG
ACTCGAAAGAAGGAATCTGGTGTCCATTCCTCGGCCAAGGAACTGAAGCCCCTCCCAAAGGTACCATC
T
AAAACAAGTACACTTGAAACCCCCTGGGATGTAAGAAACGATAAACACAGGCCAATTCCAGAAGCCAGG
AAG
TTCGAATCCGTGTTTTTCCACTCGTTGGCTGGACCTAAAAGCTCCAGAAGGGATCCCAGAGAACAGG
CC
CCAAAGAATAAAGCCCCAGATTTTCCAGAAAATGAACCCCCAGTCAAGAAGCAGTTTACAAAGAGTGC
A
TACAGAGGCTTTGAGAGTGTGAAGCAGACGATGCAGGCACCTCTGCATCCGTCCTGGGAAGCGAGCAGG
AGG
CGGAAGGAGCAGCAGTCCAAAATCGCTGTGTTTCAGGGGAAAAAAATTACATTTGATGATTGA


Translation (441 aa):
MAADPLPPSAMVQPGTLNLNNEVVKMRKEVKRIRVLVIRKLVRSVGRLKSKKGTEDALLKNQRRAQRLLE
E
IHAMK
ELKPDVVTKSALSDDINFEKTCKKPDSTATDRAVARLAGHPLLKKKIDVLKDAVQAFKDARQSA
P
AAESSESTSGEGRCKDIARSKDDARESQHPERTVVREQKAKDTNTAAKNAASGSKEKLAKTEQAPRAGT
T
PGSQGRPSGKGAGVNSEHQGAPAPGDSNQGKASTKTPEDSVCEPANNGVSEEEESEGEKEYFDDSTEER
F
YKQSSASEDSDSGDDFFIGKVRRTRKKESGVHSSAKELKPLPKVPSKTSTLETPWDVRNDKHRPIPEAR
K
FESVFFHSLAGPKSSR
RDPREQAPKNKAPDFPENEPPVKKQFTKSAYRGFESVKQTMQAPLHPSWEASR
R
RKEQQSKIAVFQGKKITFDD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser