NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37622.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37622.1 Public Mus musculus 17 Adgrf5 21 106 86 CCDS HistoryNCBI Gene:224792Re-query CCDS DB by CCDS ID:37622.1Re-query CCDS DB by GeneID:224792See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 37622.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113599 ENSMUSP00000109229 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113599Link to Ensembl Protein Viewer:ENSMUSP00000109229Re-query CCDS DB by Nucleotide ID:ENSMUST00000113599Re-query CCDS DB by Protein ID:ENSMUSP00000109229
Original member Current member NCBI NM_001081178.1 NP_001074647.1 Accepted alive Link to Nucleotide Sequence:NM_001081178.1Link to Protein Sequence:NP_001074647.1Re-query CCDS DB by Nucleotide ID:NM_001081178Re-query CCDS DB by Protein ID:NP_001074647Link to BLAST:NP_001074647.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074647.1 1348 G5E8Q8 1348 100% 0 0

Chromosomal Locations for CCDS 37622.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 43403942 43404043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43410502 43410556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43422498 43422656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43424415 43424591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43424714 43424823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43426285 43426343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43426939 43427084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43428445 43428666 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43430504 43430707 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43437516 43437686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43439951 43440160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43441784 43442002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43444987 43445139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43446004 43446212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43446873 43447052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43449792 43451195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43452280 43452321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43452416 43452475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43453071 43453155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 43455256 43455335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4047 nt):
ATGAGATCGCCAAGGACCTTCACGTTCTACTTCCTGCTTCTTGTGATTTGTTCTTCAGAAGCTGCGCTGA
GC
ACACCAACAGAGCCCATTGTTCAACCTTCAATTCTCCAAGAACATGAGCTAGCCGGGGAAGAGCTACT
G
AGGCCAAAAAGAGCAGCTGCAGCGGGTGATCGCGTGGCGGAAGAATACATGGTGGATATTGAGATCAGC
TTT
GAAAATGTCTCCTTCCTGGAGTCCATCAGAGCTCACTTGAACAACCTCAGTTTTCCAATTCGAGGGA
CC
GAAGCTGACATTTTGAACATAGCAATGACTACAGTCTGCACTCCTGCTGGAAATGACCTCTTGTGCTT
C
TGTGAGAAAGGCTACCAGTGGTCTGAGGAAAGGTGTCTCCACTCTCTCACTTGTCAAGACTATGACAGT
GCC
CTGCCAGGCGGCTACTGCAGTTGTCTGAAAGGACTTCCTCCCCAGGGACCTTTCTGCCAGCTCCCAG
AA
GCATTCATTACCTTAAAACTCAAAGTCAGACTGAACATAGGATTTCAAGAAGACCTAAAGAACACGTC
T
TCTGCCCTCTATAGGTCCTACAAGACTGATCTGGAAAGAGCGTTCCGAGCGGGTTACAGAACTTTACCA
GGA
TTCAGATCGGTGACTGTGACACAGTTCACCAAGGGCAGCGTGGTTGTGAACTACGTAGTCCGGGTTA
CA
TCGGCACCACTGCCTGGATCTATTCATAAAGCCAATGAACAAGTCATACAGAACCTCAACCATACTTA
C
AAAATGGACTACAACTCCTTCCAGGGAACCCCGAGCAATGAGACGAAATTCACTGTCATACCAGAATTC
ATC
TTTGAGGGAGACAATGTGACTCTGGAGTGTGAAACTGAGTTCGTGACCTCCAACACGTCTTGGTACT
AT
GGAGAAAAACGCTCTGACATCCAGAACAGCGACAAATACTCCATTCACACCACTGTCATCAACAATAT
A
AGCCTGATCACCCGCCTTACCATTTACAACTTCACACAGCATGATGCGGGCATGTATGGTTGCAATGTG
ACA
TTGGATATTTTTGAATATGGAACAGTCAGAAAATTAGATGTCACTCCCATCCGGATTTTGGCCAAGG
AG
GAGAGAAAGGTGGTGTGTGACAACCATCCTATATCGCTGAACTGCTGCAGCGAGAATATTGCAAACTG
G
AGCAGTATTGAATGGAAACAGGAAGGGAAGATAAGCATTCTAGGGAACCCAGAATCAGACCTAGAGTCT
AGC
TGCAGCACTTACACGCTCAAGGCAGATGGAACCCAGTGTCCCAGTGGGTCTTCTGGAACAACAGTCA
TC
TACACATGCGAGTTCGTCAGTGCCTATGGAGCCAGAGGCAGTAAGAACATAGCTGTGACCTTCACCTC
T
GTAGCCAACCTAACAATAACCCGGGACCCAATTTCTGTTTCTGAGGGACAAAGCTTTTCTATAACCTGC
CTC
AGCGATGTGAGTAGCTTTGATGAGGTGTACTGGAACACCTCAGCTGGTATTAAAATCCACCCAAGGT
TT
TATACCATGAGGAGGTATCAGGATGGAGCAGAGTCGGTGCTGATGGTGAAGACCTCCACCCGAGAGTG
G
AACGGAACCTACCACTGCATATTTAGATATAAGAATTCATACAGCATTGCCACCAAAGATGTCACCGTT
CAC
CCGCTGCCTCTGGTGTCAGACATCATGATGGATCCTTTGGAAGCCAGTGGTCTGTGTACCAGTTCCC
AT
CAATTCAAATGCTGCGTAGAAGAGGATGCAGGGGAAGAGTACGCTGTGACTTTCCACGTGGACTCCTC
A
TCCTTTCCCGCTGAAAGAGAAGTTATCGGCAAGCAAGCATGCTACACATACAGTCTCCCAGCGAACTTA
CCT
CGATGTCCCAAAGACATCGCAGTGTTCTGCCACTTCACCAATGCAGCCAACAGCTCAGTCCGGAGCC
CA
TCTATGAAGCTCAAACTTATTCCAAGGGAGAATGTCACATGCCAGGATCCCATCATTGGCATTGGGGA
T
CCTGGGAAAGTCATTCAGAAGCTGTGCCAGTTCTCAGGTGTTTACGGAAGCCCTGGACAGGCCATCGGC
GGG
ACTGTCACTTACAAATGTGTGGGCACCCAGTGGAAGGAGGAGTCAAGGGCCTGCATCTCAGCTCCAA
TC
AATGGTTTGCTCCAGGTGGCCAAGGCTTTGATCAAGAGCCCCACCCAGGACCAGAAGCTCCCTACATA
C
CTGAGGGACCTTTCTGTTAGTGCTGGGAAGGAAGAACAGGACATCCGCTCATCTCCAGGAAGCCTGGGA
GCC
ATCATCAGCATCCTTGACTTGCTCTCAACGGTTCCCACCCAAGTGAATTCAGAAATGATGAGAGACA
TA
CTTGCTACCATTAACGTCATCTTAGACAAGTCTGCCTTGAACTCCTGGGAGAAGTTGCTACAGCAACA
G
AGCAATCAGAGTTCTCAGTTCCTGCACTCCGTGGAAAGGTTTTCCCAAGCCCTCCAGCTGGGAGACAGC
ACT
CCTCCATTCCTCGCCCACCCTAACGTTCAGATGAAGAGCATGGTGATAAAACGTGGCCACCCCCAAA
TC
TACCAACAGCAGTTTATCTTCAAAGACTCTGACCTGTGGGGTGATGTAGCCATTGATGAGTGTCAGCT
G
GGAAACTTGCAGCCTGATTCATCGATCGTTACTGTGGCTTTCCCAACTCTCAAAGCCATCCTTGCCCAG
GAT
GTACAGAGAAAGACATCCTCCAACAGCTTAGTAATGACAACCACTGTCAGCCATAACATTGTCAAGC
CA
TTTAGGATTTCTATGACTTTTAAGAACAACCATCGTTCGGGTGGCAAGCCACAGTGTGTCTTCTGGAA
C
TTCAGTCTTGCCAACAATACAGGGGGCTGGGACAGCAGTGGGTGCTCTGTGGAAGATGATGGTAGGGAC
AAT
AGGGACAGAGTCTTCTGCAAGTGTAACCACCTGACGTCATTCTCCATCCTCATGTCCCCAGACTCCC
CA
GATCCAGGGTCTCTTTTAAAAATACTTCTGGATATCATTTCTTACATCGGGTTGGGGTTTTCCATAGT
C
AGCTTAGCTGCCTGTCTAGTTGTGGAAGCCATGGTGTGGAAATCTGTGACCAAGAACCGAACTTCCTAT
ATG
CGCCACATCTGCATAGTCAACATTGCCTTTTGCCTTCTGATTGCTGACATCTGGTTCATTGTGGCTG
GT
GCTATCCACGACGGTCGCTACCCACTCAACGAAACAGCCTGTGTGGCCGCCACATTCTTCATTCACTT
C
TTCTACCTCAGTGTCTTCTTCTGGATGCTAACTCTAGGCCTCATGCTCTTCTACCGGCTGATTTTCATT
CTA
CACGATGCAAGCAAGTCCACTCAGAAAGCCATCGCATTTTCTCTAGGCTATGGCTGTCCCCTCATTA
TC
TCCTCTATCACAGTGGGGGTTACGCAGCCACAGGAAGTCTACATGAGGAAGAACGCGTGTTGGCTCAA
C
TGGGAGGACACCAGAGCACTGCTGGCTTTTGCCATCCCCGCGTTGATTATTGTGGTGGTAAATGTGAGC
ATC
ACAGTTGTGGTCATCACCAAGATCCTGAGGCCCTCCATTGGGGACAAGCCAGGCAAGCAAGAGAAGA
GC
AGCCTATTCCAGATCAGCAAGAGTATCGGGGTCCTCACACCACTCTTGGGGCTCACTTGGGGTTTCGG
T
CTTGCCACAGTGATCCAGGGAAGCAATGCTGTGTTCCACATCATATTTACTCTCCTCAATGCCTTCCAG
GGG
CTCTTCATTTTGCTCTTTGGCTGCCTCTGGGATCAGAAGGTGCAGGAAGCTTTGCTGCATAAGTTTT
CA
TTGTCAAGGTGGTCTTCTCAACACTCAAAGTCAACATCCATAGGTTCGTCAACACCCGTGTTTTCAAT
G
AGTTCTCCAATATCCCGAAGATTTAATAATCTTTTTGGTAAAACAGGAACATATAACGTTTCCACCCCA
GAG
ACAACCAGTTCATCCCTGGAAAATTCCTCTAGTGCTTACTCACTGCTCAACTAG


Translation (1348 aa):
MRSPRTFTFYFLLLVICSSEAALSTPTEPIVQPSILQEHELAGEELLRPKRAAAAGDRVAEEYMVDIEIS
F
ENVSFLESIRAHLNNLSFPIRGTEADILNIAMTT
VCTPAGNDLLCFCEKGYQWSEERCLHSLTCQDYDS
A
LPGGYCSCLKGLPPQGPFCQLPE
AFITLKLKVRLNIGFQEDLKNTSSALYRSYKTDLERAFRAGYRTLP
G
FRSVTVTQF
TKGSVVVNYVVRVTSAPLPGSIHKANEQVIQNLNHTYKMDYNSFQGTPSNETKFTVIPEF
I
FEGDNVTLECETEFVTSNTSWYYGEKRSDIQNSDKYSIHTTVINNISLITRLTIYNFTQHDA
GMYGCNV
T
LDIFEYGTVRKLDVTPIRILAKEERKVVCDNHPISLNCCSENIANWSSIEWKQEGKISIL
GNPESDLES
S
CSTYTLKADGTQCPSGSSGTTVIYTCEFVSAYGARGSKNIAVTFTSV
ANLTITRDPISVSEGQSFSITC
L
SDVSSFDEVYWNTSAGIKIHPRFYTMRRYQDGAESVLMVKTSTREWN
GTYHCIFRYKNSYSIATKDVTV
H
PLPLVSDIMMDPLEASGLCTSSHQFKCCVEEDAGEEYAVTFHVDSSSFPA
EREVIGKQACYTYSLPANL
P
RCPKDIAVFCHFTNAANSSVRSPSMKLKLIP
RENVTCQDPIIGIGDPGKVIQKLCQFSGVYGSPGQAIG
G
TVTYKCVGTQWKEESRACISAPINGLLQVAK
ALIKSPTQDQKLPTYLRDLSVSAGKEEQDIRSSPGSLG
A
IISILDLLSTVPTQVNSEMMR
DILATINVILDKSALNSWEKLLQQQSNQSSQFLHSVERFSQALQLGDS
T
PPFLAHPNVQMKSMVIKRGHPQIYQQQFIFKDSDLWGDVAIDECQLGNLQPDSSIVTVAFPTLKAILAQ
D
VQRKTSSNSLVMTTTVSHNIVKPFRISMTFKNNHRSGGKPQCVFWNFSLANNTGGWDSSGCSVEDDGRD
N
RDRVFCKCNHLTSFSILMSPDSPDPGSLLKILLDIISYIGLGFSIVSLAACLVVEAMVWKSVTKNRTSY
M
RHICIVNIAFCLLIADIWFIVAGAIHDGRYPLNETACVAATFFIHFFYLSVFFWMLTLGLMLFYRLIFI
L
HDASKSTQKAIAFSLGYGCPLIISSITVGVTQPQEVYMRKNACWLNWEDTRALLAFAIPALIIVVVNVS
I
TVVVITKILRPSIGDKPGKQEKSSLFQISKSIGVLTPLLGLTWGFGLATVIQGSNAVFHIIFTLLNAFQ

G
LFILLFGCLWDQK
VQEALLHKFSLSRWSSQHSKSTSIGSSTPVFSMSSPISRRFNNLFGKTGTYNVSTP
E
TTSSSLENSSSAYSLLN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser