NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37618.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37618.1 Public Mus musculus 17 Mmut 21 106 86 CCDS HistoryNCBI Gene:17850Re-query CCDS DB by CCDS ID:37618.1Re-query CCDS DB by GeneID:17850See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 37618.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000169611 ENSMUSP00000130941 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169611Link to Ensembl Protein Viewer:ENSMUSP00000130941Re-query CCDS DB by Nucleotide ID:ENSMUST00000169611Re-query CCDS DB by Protein ID:ENSMUSP00000130941
Original member Current member NCBI NM_008650.3 NP_032676.2 Accepted alive Link to Nucleotide Sequence:NM_008650.3Link to Protein Sequence:NP_032676.2Re-query CCDS DB by Nucleotide ID:NM_008650Re-query CCDS DB by Protein ID:NP_032676Link to BLAST:NP_032676.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032676.2 748 P16332 748 100% 0 0

Chromosomal Locations for CCDS 37618.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 40937084 40937462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40938515 40938882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40941316 40941473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40943807 40943978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40947022 40947270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40951755 40951866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40952779 40952894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40955102 40955217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40956207 40956338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40958330 40958477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40958702 40958869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40960568 40960696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2247 nt):
ATGTTGAGAGCTAAGAATCAACTTTTTTTGCTATCGCCCCATTACCTGAAGCAGCTAAACATTCCATCAG
CT
TCCAGATGGAAACGCCTTCTACACCAGCAGCAACCCCTTCACCCAGAATGGGCTGTACTGGCCAAAAA
G
CAGCTGAAAGGCAAAAACCCAGAGGACCTTATATGGCACACCCCAGAAGGGATCTCTATAAAGCCCTTA
TAT
TCCAGGGCAGATACTCTGGACTTACCCGAAGAACTTCCAGGAGTGAAGCCATTCACACGGGGACCAT
AT
CCTACCATGTATACCTATAGGCCCTGGACCATCCGTCAGTATGCAGGCTTTAGTACTGTGGAAGAAAG
C
AATAAATTCTATAAGGACAATATTAAGGCTGGTCAGCAGGGGTTGTCTGTTGCCTTTGACTTGGCAACA
CAT
CGTGGTTATGATTCAGACAACCCCAGAGTTCGTGGAGATGTTGGAATGGCTGGAGTTGCTATTGACA
CT
GTAGAAGACACCAAAATCCTATTTGATGGCATTCCTTTAGAAAAAATGTCCGTTTCCATGACTATGAA
C
GGAGCTGTCATCCCAGTCCTGGCAACATTTATAGTAACTGGGGAAGAGCAAGGTGTGCCGAAGGAGAAG
CTC
ACTGGCACAATTCAGAATGACATCCTAAAGGAGTTTATGGTCAGAAATACTTATATTTTTCCCCCAG
AG
CCATCGATGAAAATTATTGCTGACATTTTCCAATACACAGCACAGCACATGCCAAAATTTAATTCCAT
T
TCGATTAGCGGGTACCATATGCAGGAAGCAGGAGCTGATGCCATTTTAGAACTGGCCTATACCATCGCA
GAT
GGGTTGGAGTACTGCAGAACTGGACTCCAGGCTGGACTCACAATTGATGAATTTGCACCAAGGTTGT
CT
TTCTTCTGGGGAATTGGAATGAACTTCTACATGGAAATAGCCAAGATGCGAGCTGGGAGAAGACTGTG
G
GCTCACTTAATAGAAAAAATGTTCCAGCCTAAAAACTCTAAATCTCTTCTTCTAAGAGCACACTGCCAG
ACA
TCGGGGTGGTCACTTACTGAGCAGGATCCTTACAATAACATTGTCCGCACTGCAATCGAAGCCATGG
CA
GCTGTGTTTGGAGGAACCCAGTCTTTGCATACGAACTCTTTTGATGAAGCGCTGGGTTTGCCCACTGT
G
AAAAGTGCCCGGATTGCTCGGAACACACAGATCATCATTCAGGAAGAATCTGGGATCCCCAAAGTGGCG
GAT
CCTTGGGGAGGGTCGTACATGATGGAGTCGCTCACAAATGACGTTTATGAGGCTGCTCTGAAGTTGA
TA
TATGAAGTTGAAGAAATGGGTGGAATGGCCAAAGCTGTAGCTGAAGGAATCCCTAAACTTCGCATTGA
A
GAATGTGCTGCCCGAAGACAAGCTAGAATAGATTCTGGTTCTGAGGTAATTGTTGGAGTAAATAAGTAT
CAG
TTGGAAAAAGAAGACTCTGTGGAGGTCCTGGCCATTGACAACACTTCAGTGCGTAAGAAGCAGATTG
AA
AAACTCAAGAAGATTAAATCCAGCAGGGATCAAGCTTTGGCTGAGCAGTGTCTCAGTGCACTTACCCA
G
TGTGCTGCCAGTGGAGATGGCAATATTCTGGCTCTGGCAGTGGATGCAGCTCGTGCAAGATGTACAGTT
GGA
GAAATCACGGATGCCTTGAAAAAAGTATTTGGTGAGCATAAAGCTAATGATCGTATGGTGAGTGGAG
CA
TATCGGCAGGAGTTTGGAGAAAGTAAAGAGATCACATCTGCCATCAAGAGAGTTAATAAATTCATGGA
A
CGTGAAGGTCGCAGACCTCGTCTTCTTGTGGCAAAAATGGGACAAGATGGCCATGACAGGGGAGCCAAG
GTC
ATTGCTACAGGATTTGCTGATCTTGGTTTTGATGTGGACATAGGCCCTCTTTTTCAGACTCCCCGTG
AA
GTGGCGCAGCAAGCTGTGGATGCAGATGTCCATGCTGTGGGTGTCAGCACACTTGCTGCTGGTCATAA
A
ACCCTCGTTCCTGAGCTTATCAAAGAACTCACCGCCCTGGGGCGGCCAGATATCCTTGTCATGTGTGGG
GGC
GTGATTCCACCACAGGATTATGAATTTCTGTATGAAGTTGGTGTTTCCAACGTCTTTGGTCCTGGAA
CC
CGGATTCCAAGAGCTGCTGTCCAAGTGCTTGATGATATTGAGAAGTGTTTGGCAGAGAAGCAGCAGTC
T
GTGTAA


Translation (748 aa):
MLRAKNQLFLLSPHYLKQLNIPSASRWKRLLHQQQPLHPEWAVLAKKQLKGKNPEDLIWHTPEGISIKPL
Y
SRADTLDLPEELPGVKPFTRGPYPTMYTYRPWTIRQYAGFSTVEESNKFYKDNIK
AGQQGLSVAFDLAT
H
RGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGAVIPVLATFIVTGEEQGVPKEK
L
TGTIQNDILKEFMVRNTYIFPPEPSMKIIADIFQYTAQ
HMPKFNSISISGYHMQEAGADAILELAYTIA
D
GLEYCRTGLQAGLTIDEFAP
RLSFFWGIGMNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLLRAHCQ
T
SGWSLTEQ
DPYNNIVRTAIEAMAAVFGGTQSLHTNSFDEALGLPTVKSARIARNTQIIIQEESGIPKVA
D
PWGGSYMMESLTNDVYEAALK
LIYEVEEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVGVNKY
Q
LEKEDSVEVLAIDNTSVRKKQIEKLKK
IKSSRDQALAEQCLSALTQCAASGDGNILALAVDAARARCTV
G
EITDALKKVFGEHKANDRMVSGAYRQEFGESKEITSAIK
RVNKFMEREGRRPRLLVAKMGQDGHDRGAK
V
IATGFADLGFDVDIGPLFQ
TPREVAQQAVDADVHAVGVSTLAAGHKTLVPELIKELTALGRPDILVMCG
G
VIPPQ
DYEFLYEVGVSNVFGPGTRIPRAAVQVLDDIEKCLAEKQQSV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser