NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37475.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37475.1 Public Mus musculus 17 Srrm2 21 106 86 CCDS HistoryNCBI Gene:75956Re-query CCDS DB by CCDS ID:37475.1Re-query CCDS DB by GeneID:75956See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37475.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000088621 ENSMUSP00000085993 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000088621Link to Ensembl Protein Viewer:ENSMUSP00000085993Re-query CCDS DB by Nucleotide ID:ENSMUST00000088621Re-query CCDS DB by Protein ID:ENSMUSP00000085993
Original member Current member EBI,WTSI OTTMUST00000126188 OTTMUSP00000068294 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000126188Link to Vega Protein Viewer:OTTMUSP00000068294Re-query CCDS DB by Nucleotide ID:OTTMUST00000126188Re-query CCDS DB by Protein ID:OTTMUSP00000068294
Original member Current member NCBI NM_175229.3 NP_780438.2 Accepted alive Link to Nucleotide Sequence:NM_175229.3Link to Protein Sequence:NP_780438.2Re-query CCDS DB by Nucleotide ID:NM_175229Re-query CCDS DB by Protein ID:NP_780438Link to BLAST:NP_780438.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780438.2 2607 Q8BTI8-2 2607 100% 0 0

Chromosomal Locations for CCDS 37475.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 23808112 23808173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23808354 23808518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23809969 23810046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23810413 23810475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23810739 23810771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23811031 23811081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23811639 23811731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23812428 23812620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23815122 23821690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23822413 23822700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23823791 23823904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23824016 23824120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 23824216 23824225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7824 nt):
ATGTTGCTGGAAAAGGATGTGAACCCTGGGGCCAAGGAAGAAACCCCAGGGCAGAGACCAGTGGTAACTG
AG
ACCCATCAGTTGGCAGAACTGAATGAGAAGAAGAATGAACGACTCCGTGCTGCCTTTGGCATCAGTGA
C
TCCTATGTGGATGGCAGTTCTTTTGATCCTCAGAGACGTGCTCGAGAAGCTAAACAAATAGCTCCTGAG
CCT
CCCAAACCATACAGCCTTGTTCGAGAGACCAGCAGTTCTCGCTCACCAACTCCAAAGCAAAAGAAGA
AG
AAAAAGAAGAAAGATAGAGGACGCAGGTCAGAGAGCAGTTCTCCTCGACGAGAGAGGAAGAAGAGTTC
A
AAGAAGAAGAAGCACAGGTCAGAATCTGAGTCCAAGAAACGGAAACACAGGTCTCCTACTCCAAAGAGC
AAA
CGCAAATCAAAGGACAAGAAGAGGAAACGGTCTCGAAGTACAACACCAGCTCCTAAGAGCCGTCGAG
CT
CATCGGTCAACTTCTGCGGACTCTGCTTCTTCCTCTGATACTTCTCGTAGTCGGTCTCGAAGTGCTGC
T
GCTAAAATTCATACAACAGCCTTGACTGGGCAAAGTCCTCCCCTTGCTTCAGGGCATCAAGGGGAGGGA
GAT
GCACCTTCTGTTGAACCAGGTGCCACCAACATACAACAACCTAGTAGCCCAGCTCCCTCTACAAAGC
AA
TCTAGCAGTCCTTATGAAGACAAAGATAAGAAAGAGAAATCTGCAGTTCGACCTAGCCCCTCTCCGGA
A
AGGAGCAGCACAGGGCCAGAACTACCTGCCCCTACTCCGCTCCTTGTTGAGCAACATGTCGACTCCCCA
CGA
CCCCTTGCAGCAATCCCGTCCAGTCAGGAGCCAGTTAACCCCTCATCTGAGGCTTCCCCAACCCGGG
GC
TGTTCACCACCTAAGTCTCCTGAGAAACCTCCCCAGTCTACTTCCTCAGAAAGTTGCCCACCATCCCC
T
CAACCTACCAAAGGTTCTCGGCATGCCAGCTCTTCTCCTGAAAGTCTTAAACCCACACCAGCTCCTGGG
TCC
CGTCGAGAGATTTCTTCTTCACCCACATCTAAGAATCGCTCGCATGGCAGAGCAAAGCGGGATAAAT
CT
CATTCTCATACCCCATCTCATAGAGCAGGGAGGTCTCGTAGTCCTGCCACTAAGAGGGGACGGTCTCG
A
TCTAGAACCCCCACCAAGAGAGGTCACTCCAGGTCCCGGTCCCCTCAGTGGAGAAGGTCAAGATCTGCA
CAG
AGGTGGGGAAAATCTAGAAGTCCCCAGAGGCGTGGCCGTTCAAGGTCTCCTCAGAGGCCAGGTTGGT
CC
AGGAGCAGAAATACCCAGAGAAGAGGCAGGTCTAGGTCAGCAAGGCGAGGCAGATCACATTCTAGATC
T
CCAGCTACTAGGGGCAGATCCCGATCTAGAACACCAGCTAGAAGGGGTAGGTCTCGGTCCAGAACACCT
GCC
AGGCGAAGATCACGATCCAGAACACCTGCCAGGCGTAGGTCTCGGTCTAGAACACCAGCTCGCAGGG
GC
AGGTCCAGATCAAGAACACCCGCTCGCCGCAGGTCTAGGACACGATCACCAGTTCGAAGGAGGTCTCG
G
AGTAGATCCCAAGCTAGGAGAAGTGGTAGGTCTAGGTCCAGAACACCAGCCAGGAGAAGTGGCAGGTCA
AGA
TCTAGAACACCAGCCAGGAGAGGGAGGTCCCGGTCTAGAACGCCAGCCAGAAGAAGCGCTCGATCTC
GG
TCTAGAACGCCAGCCAGGAGAGGGAGGTCACGATCCAGAACACCAGCACGACGACGATCTCGAAGTAG
A
AGTCTTGTGAGACGTGGAAGATCTCACTCTAGAACACCACAAAGAAGAGGACGATCTGGCTCATCCTCA
GAG
AGGAAGAACAAATCTAGAACATCTCAGAGGAGAAGCAGATCCAACTCAAGCCCAGAAATGAAAAAAT
CT
CACGTTTCCTCAAGACGGAGCAGGTCTCTTTCTTCACCACGATCCAAAGCAAAATCTTTGAGGCGAAG
C
CTTTCAGGTTCCTCTCCATGTCCTAAACAAAAGTCACAGACACCAACCAGGCGAAGTCGTTCTGGTTCT
TCA
CCACCTAAACAAAAGTCAAAAACACCACCAAGACAGAGTCGTTCAAATTCTCCTCAGCCTAAAGTAA
AA
TCTGGAACACCACCAAGACCAGGGTCTGTAACAAACATGCAGGCTGATGAATGCACTGCAACACCACA
G
AGACAGAGCCATTCTGAATCATCACCTGATGGTGAGGTGAAATCAAGGACCCCATCAAGACAAAGCTGC
TCT
GGGTCTTCTCCTCGAGTGAAATCTAGCACACCTCCAAGACAGAGCCCATCTAGGTCGTCATCTCCAC
AA
CCCAAAGTGAAGACAGTGATATCACCAAGAGGAAGAAGCCATTCTAGCTCCTCTTCTCCAAGTCCTAG
T
AGAGTGACATCTAGGACACCTCAGAGGAAAAGCAGATCAATATCTCCTTGCCCCAAGGTAGACTCTAGA
TTA
AGACATAGCCGTTCTAGATCCTCCTCACCAGATTCCAAGATGGAACTGGGAACACCACTGAGACACT
CA
GGATCTACATCTCCATATCTAAAAAGCATGCTCCAGACTCCACCAGATCAAAATCTTTCTGGATCAAA
G
TCACCCTGTCCCCAGAAGTCTAGGGATTCACCAACAGGAAGCTCTGGATCTTTTCACCTCTGTCCAGGT
GTA
ACACCTAGTAGTATAGTACCAGGAGAGAGCTGTTTTAGCGCCTCATTTGTGCAACAAAAAGGACACA
CT
CAAACTTGGCCAGATACTTCAAGTCCAGAAGTCATGCAGACTCAAGTGGAATCTCCATTGCTGCAGAG
C
AAATCCCAAACATCTCCTAAGGGTAGCCTTTCCAGATCTTCATCTCCAGTCACTGAGCTGACAGCCAGA
TCA
CCAGTAAAACAAGATAAAAGTGAAATATCAACAGATCCAAAGCTGAAGTCAGGAATGTCTCCTGAGC
AG
AGTAAGACTAAACCTGACTCTAGCATATATCCTTTAGTAGACTCTAAATCTTTTCTGGTGCAGAGCAG
A
TTGGAGCCTTCTGAATTAAAAGAGAGACTGGGTTTAATTCAAGAGGATGTTGCATCATCTTGTATACCA
AGA
GACAAATTTAGTCCTACACAGGATAGGCCTGAGTCTTCCACAGTACTGAAAGTCACACCTAGAGTAC
TA
TTAAAAGAAAGAAGTGGAGCTGGCTCACCTCCAGGCAAAAGAGACCAAAAAAGTTTATTACCTAATTC
A
AGTCAAGATGAACTAATGGAAGTAGAAAAGTCTGAGCAACCTTTAAGCCAAGTTCTACCCAGTTTATCT
CCA
GAACATAAAGAAATGCCTGGAAGTAACATTGAGTCATCTCCTGAAGTAGAAGAAAGGCCTGCTGTAT
TG
TCTGCTCTTGACCAAAGCCAGTCACAGCCTTCAAAAGCAGCAGAAACCCCTGCAGTGGCTTCATGTTG
G
AGTGGGCCACAAGTTTCTCCAGAGCATAAAGAACTATCTCATTCTCCCCCAAGGGAGAATAGCTTTGAG
TCA
TCTTTAGAGTTTAAAAACTCAGGCCCTGTTTCAGAAGTAAATACTGGCTTTTCTCCTGAGGTTAAAG
AA
GAATTGAATGGATCATTCCTTAATCAAACAGAGGCAGATCCATCTGTGGACATGAAAGAACAGTCAAG
G
TCTTCCAGGCGAAGCAGTTCTGAGTTATCCCCAGAAGTAGTGGAAAAGGTAGGATTATTTTCAAGTCAG
AAA
GTATCTTCGCCTGTACTTGAGACTGTACAACAAAGAACACCTTCAAGAGAAAGAAGTAGTTCTGCAT
CT
CCTGAACTGAAAGATGGTTTGCCTAGAACGCCATCTAGGAGAAGCCGGTCTGGGTCTTCTCCAGGACT
T
AGAGATGGGTCTGGGACTCCTTCTAGGCATAGCCTATCTGGGTCCTCTCCTGGGATGAAAGATACACCT
CAA
ACCCCCTCCAGGGGACGAAGTGAATGTGACTCTTCTCCAGAACCAAAAGCATTGCCTCAGACTCCTA
GA
GCCCGAAGTCATTCTCCATCATCCCCAGAGCGCAACAACAAGAGTGTCACCCCTCAGAGAGAAAGAAG
T
GGGTCAGAATCATCAGTAGAACAGAAAAATCTGGCTAGGACCTCTCCGGGACAAAGAAGTCGATCTGGG
TCT
TCCCAAGAGCTTGATGGAAAGCCCAGCGCGTCCCCACAGGAAAGAAGTGAGTCAGACTCTTCTCCAG
AT
TCCAAACCCAAGACTCGGACTCCTCTCAGACAGAGGAGTCACTCTGGATCATCTCCAGAGGTTGACAG
C
AAATCTCGACACTCACCCAGGCTCAGTAGGTCTGGCTCATCTCCGGAAATGAAAGATAAGCCAAGAGTG
CTA
CAGAGGGCTCAGAGTGGTACTGATTCTTCTCCTGAACACAAGATACCTGCTCCTCGGGCCCTGCCCA
GG
CATAGTAGATCAGGTTCATCAAGCAAAGAGAGAGGTCCTTCCCCTGAAGGAAGCAGTAGTTCTGAGTC
T
TCTCCAGAACACGCCCCCAAATCCAGAACTGCTCGAAGAGGTTCCAGGTCCTCAATAGAGCCAAAGACA
AAG
TCTCACACACCACCTCGACGCCGGAGCTCTCGATCATCTCCTGAGCTAACCAGGAAGGCTAGAGTCT
CT
CGTAGAAGCCGGTCTGCCTCCTCATCACCAGAAATCCGCTCCAGAACTCCACCAAGACGCAGAAGAAG
T
CCTTCAGTATCTTCACCAGAGCCAACTGAAAAGTCAAGGTCTTCACGGAGGAGGCGCTCAGTTTCTTCT
CCC
CGTACCAAGACAACTTCGAGGAGAGGACGGTCTCCTTCACCCAAACCTCGTGGACTCCAAAGATCCC
GA
TCCCGCTCACGGAGAGAGAAAACCAGAACAACCCGACGCAGAGATAGATCTGGATCATCTCAGTCAAC
A
TCTCGAAGAAGACAGAGGAGCCGGTCTAGATCACGAGTTACTCGGAGACGGAGGGGTGGCTCTGGTTAC
CAT
TCAAGATCACCTACCAGACAGGAGAGTTCTCGAACCTCCTCTAGACGCAGAAGAGGCCGCTCCCGGA
CA
CCCTTGACCAGTCGGAAGCGATCTCGATCAAGAACATCACCAGCTCCTTGGAAGCGCTCTAGATCTCG
A
GCCTCACCAGCTACTCATCGGCGGTCCAGGTCCAGAACACCACTGATAAGCCGACGTAGGTCCAGATCT
CGG
ACCTCACCTGTGAGTAGGAGACGGTCAAGGTCAGTGAATAGGCGTAGATCTCGATCAAGAGCATCCC
CA
GTGAGTCGAAGGCGATCCAGGTCCAGAACACCACCAGTAACTCGTCGTCGTTCAAGATCCAGAACACC
A
ACTCGCCGTCGTTCTCGTTCTAGGACTCCTCCAGTGACTCGCAGAAGGTCCAGATCCAGGACTCCACCA
GTA
ACCAGGAGGCGATCTAGAAGCAGAACTTCACCTGTTACTAGAAGAAGATCAAGATCCAGGACATCCC
CA
GTCACCCGGAGAAGATCGAGATCTCGAACATCTCCAGTCACCCGGAGGCGGTCCCGTTCCCGAACCTC
T
CCAGTGACAAGACGACGCTCCAGGTCTCGAACTCCGCCAGCAATTCGAAGACGATCTAGGTCTCGGACA
CCA
CTGTTGCCACGCAAGCGCTCTCGAAGCCGCTCACCACTTGCTATCCGCCGCCGTTCTAGGTCTCGTA
CT
CCTAGGGCAGCTCGAGGCAAGCGGTCCTTAACAAGATCTCCTCCAGCCATTCGTAGGCGGTCTGCATC
T
GGAAGTAGTTCTGATCGTTCACGTTCTGCCACTCCTCCAGCAACAAGGAATCATTCTGGATCTCGGACA
CCT
CCTGTAGCACTCAGTAGCTCTAGAATGAGTTGCTTTAGCCGTCCTAGCATGTCACCAACTCCTCTTG
AC
CGATGTAGATCACCTGGAATGCTTGAACCCCTTGGAAGCGCTAGAACGCCCATGTCTGTGCTACAGCA
A
ACAGGTGGCTCCATGATGGATGGTCCAGGTCCTCGGATTCCTGATCACCCAAGATCATCTGTTCCAGAA
AAC
CATGCTCAGTCTAGAATTGCACTTGCCTTGACAGCCATCAGTCTTGGTACTGCCCGGCCACCTCCAT
CC
ATGTCTGCTGCTGGCCTTGCTGCAAGAATGTCCCAGGTTCCAGCACCTGTACCTCTCATGAGCCTTAG
A
ACAGCCCCAGCTGCTAACCTTGCCAGCAGGATTCCAGCAGCATCTGCAGCAGCTATGAACCTTGCTAGT
GCC
AGGACATCTGCTATTCCGGCATCTGTGAACCTTGCTGACTCAAGAACACCAGCTGCTGCTGCAGCTA
TG
AACTTAGCCAGCCCTAGAACAGCAGTGGCTCCTTCAGCTGTGAACCTTGCAGATCCTCGAACCCCTGC
A
GCTTCAGCTGTGAACCTAGCAGGAGCTAGAACACCAGCTGCATTAGCAGCTTTGAGTCTCACAGGCTCT
GGG
ACACCTCCAACTGCTGCAAATTACCCCTCCAGTTCCAGAACACCCCAGGCTCCAACCCCCGCAAACC
TG
GTGGTGGGTCCTCGATCTGCGCATGGCACAGCTCCTGTGAATATTGCTGGCTCTAGAACCCCTGCAGG
C
TTGGCTCCCACAAATCTCTCCAGTTCCAGGATGGCTCCAGCATTGTCTGGTGCAAACCTCACCAGTCCC
AGG
GTGCCCCTTTCTGCTTATGATCGTGTTAGTGGCAGAACCTCACCTTTAATGCTTGATCGAGCCAGGT
CC
AGAACACCACCATCTGCCCCAAGCCAGTCTAGAATGACCTCTGAGCGTGAGCGGGCTCCTTCCCCTGC
T
TCAAGAATGGTTCAGGCTTCTTCGCAATCTCTTCTCCCTCCTGCACAGGATCGGCCTCGGTCCCCTGTG
CCA
TCTGCTTTTTCAGACCAATCTCGTTCAGTTGTCCAGACCACTCCTGTAGCAGGGTCTCAGTCCCTTT
CA
TCCGGGACAGTAGCGAAGTCCACATCCTCTGCTAGTGACCACAATGGCATGCTTTCTGGCCCTGCCCC
T
GGGATATCCCATGCTGAAGGTGGGGAGCCACCTGCCTCTACTGGGGCCCAGCAGCCTTCTACATTGGCT
GCT
CTGCAACCAGCTAAGGAACGTCGGAGCTCTTCCTCCTCTTCATCATCATCTAGCTCCTCCTCCTCTT
CA
TCATCTTCATCGTCATCCTCCTCTTCCTCTGGCTCCAGTTCTAGTGATTCAGAGGGTTCCAGCCTTCC
A
GCTCAACCTGAGGTGGCACTGAAAAGGGTTCCCAGCCCCACCCCAGTCCCAAAGGAGGCTATTAGAGAG
GGA
CGTCCTCAGGAACCAACCCCGGCCAAAAGGAAGAGGCGCTCTAGCAGCTCCAGTTCCAGCTCCTCCT
CC
TCCTCCTCTTCCTCTTCTTCCTCTTCCTCCTCCTCCTCATCTTCCTCCTCCTCTTCTTCCTCTTCTTC
C
TCCTCTTCTTCCTCCTCTTCCTCCTCCCCCTCCCCTGCTAAGCCTGGCCCTCAGGCATTACCCAAACCT
GCA
AGCCCCAAGAAGCCACCCCCTGGCGAGAGGAGGTCTCGAAGTCCTCGGAAGCCAATAGACTCCCTTC
GG
GATTCCCGATCCCTCAGTTACTCACCCGTTGAGCGTCGACAGCCCTCGCCCCAACCTTCACCAAGGGA
T
CTACAGAGCAGTGAGCGAGTTTCCTGGAGAGGCCAGCGAGGGGACAGTCACTCTCCTGGTCACAAGAGG
AAG
GAGACACCTAGTCCCCGTTCTAATCGTCACCGCTCCTCCAGGTCTCCATAA


Translation (2607 aa):
MLLEKDVNPGAKEETPGQRPVVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQIAPE
P
PKPY
SLVRETSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKS
K
RKSKDKKRK
RSRSTTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKIHTTALTGQSPPLASGHQGEG
D
APSVEPGATNIQQPSSPAPSTKQSSSPYEDKDKKE
KSAVRPSPSPERSSTGPELPAPTPLLVEQHVDSP
R
PLAAIPSSQEPVNPSSEASPTRGCSPPKSPEKPPQSTSSESCPPSPQPTKGSRHASSSPESLKPTPAPG
S
RREISSSPTSKNRSHGRAKRDKSHSHTPSHRAGRSRSPATKRGRSRSRTPTKRGHSRSRSPQWRRSRSA
Q
RWGKSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTP
A
RRRSRSRTPARRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSQARRSGRSRSRTPARRSGRS
R
SRTPARRGRSRSRTPARRSARSRSRTPARRGRSRSRTPARRRSRSRSLVRRGRSHSRTPQRRGRSGSSS
E
RKNKSRTSQRRSRSNSSPEMKKSHVSSRRSRSLSSPRSKAKSLRRSLSGSSPCPKQKSQTPTRRSRSGS
S
PPKQKSKTPPRQSRSNSPQPKVKSGTPPRPGSVTNMQADECTATPQRQSHSESSPDGEVKSRTPSRQSC
S
GSSPRVKSSTPPRQSPSRSSSPQPKVKTVISPRGRSHSSSSSPSPSRVTSRTPQRKSRSISPCPKVDSR
L
RHSRSRSSSPDSKMELGTPLRHSGSTSPYLKSMLQTPPDQNLSGSKSPCPQKSRDSPTGSSGSFHLCPG
V
TPSSIVPGESCFSASFVQQKGHTQTWPDTSSPEVMQTQVESPLLQSKSQTSPKGSLSRSSSPVTELTAR
S
PVKQDKSEISTDPKLKSGMSPEQSKTKPDSSIYPLVDSKSFLVQSRLEPSELKERLGLIQEDVASSCIP
R
DKFSPTQDRPESSTVLKVTPRVLLKERSGAGSPPGKRDQKSLLPNSSQDELMEVEKSEQPLSQVLPSLS
P
EHKEMPGSNIESSPEVEERPAVLSALDQSQSQPSKAAETPAVASCWSGPQVSPEHKELSHSPPRENSFE
S
SLEFKNSGPVSEVNTGFSPEVKEELNGSFLNQTEADPSVDMKEQSRSSRRSSSELSPEVVEKVGLFSSQ
K
VSSPVLETVQQRTPSRERSSSASPELKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSPGMKDTP
Q
TPSRGRSECDSSPEPKALPQTPRARSHSPSSPERNNKSVTPQRERSGSESSVEQKNLARTSPGQRSRSG
S
SQELDGKPSASPQERSESDSSPDSKPKTRTPLRQRSHSGSSPEVDSKSRHSPRLSRSGSSPEMKDKPRV
L
QRAQSGTDSSPEHKIPAPRALPRHSRSGSSSKERGPSPEGSSSSESSPEHAPKSRTARRGSRSSIEPKT
K
SHTPPRRRSSRSSPELTRKARVSRRSRSASSSPEIRSRTPPRRRRSPSVSSPEPTEKSRSSRRRRSVSS
P
RTKTTSRRGRSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGY
H
SRSPTRQESSRTSSRRRRGRSRTPLTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRS
R
TSPVSRRRSRSVNRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTRRRSRSRTPPVTRRRSRSRTPP
V
TRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRT
P
LLPRKRSRSRSPLAIRRRSRSRTPRAARGKRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRT
P
PVALSSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSARTPMSVLQQTGGSMMDGPGPRIPDHPRSSVPE
N
HAQSRIALALTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAMNLAS
A
RTSAIPASVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPAASAVNLAGARTPAALAALSLTGS
G
TPPTAANYPSSSRTPQAPTPANLVVGPRSAHGTAPVNIAGSRTPAGLAPTNLSSSRMAPALSGANLTSP
R
VPLSAYDRVSGRTSPLMLDRARSRTPPSAPSQSRMTSERERAPSPASRMVQASSQSLLPPAQDRPRSPV
P
SAFSDQSRSVVQTTPVAGSQSLSSGTVAKSTSSASDHNGMLSGPAPGISHAEGGEPPASTGAQQPSTLA
A
LQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSSLPAQPEVALK
RVPSPTPVPKEAIRE
G
RPQEPTPAKRKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKP
A
SPKKPPPGER
RSRSPRKPIDSLRDSRSLSYSPVERRQPSPQPSPRDLQSSERVSWRGQRGDSHSPGHKR
K
ETPSPRSNRHRSS
RSP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser