NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37271.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37271.1 Public Mus musculus 16 Pi4ka 21 106 86 CCDS HistoryNCBI Gene:224020Re-query CCDS DB by CCDS ID:37271.1Re-query CCDS DB by GeneID:224020See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37271.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000036161 ENSMUSP00000036162 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036161Link to Ensembl Protein Viewer:ENSMUSP00000036162Re-query CCDS DB by Nucleotide ID:ENSMUST00000036161Re-query CCDS DB by Protein ID:ENSMUSP00000036162
Original member Current member EBI,WTSI ENSMUST00000154364 ENSMUSP00000122550 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000154364Link to Ensembl Protein Viewer:ENSMUSP00000122550Re-query CCDS DB by Nucleotide ID:ENSMUST00000154364Re-query CCDS DB by Protein ID:ENSMUSP00000122550
Original member Current member EBI,WTSI OTTMUST00000081102 OTTMUSP00000043328 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081102Link to Vega Protein Viewer:OTTMUSP00000043328Re-query CCDS DB by Nucleotide ID:OTTMUST00000081102Re-query CCDS DB by Protein ID:OTTMUSP00000043328
Original member Current member EBI,WTSI OTTMUST00000081355 OTTMUSP00000043511 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000081355Link to Vega Protein Viewer:OTTMUSP00000043511Re-query CCDS DB by Nucleotide ID:OTTMUST00000081355Re-query CCDS DB by Protein ID:OTTMUSP00000043511
Original member Current member NCBI NM_001001983.2 NP_001001983.2 Accepted alive Link to Nucleotide Sequence:NM_001001983.2Link to Protein Sequence:NP_001001983.2Re-query CCDS DB by Nucleotide ID:NM_001001983Re-query CCDS DB by Protein ID:NP_001001983Link to BLAST:NP_001001983.2

Chromosomal Locations for CCDS 37271.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 17280569 17280620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17280717 17280800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17281020 17281109 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17281849 17282008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17282286 17282406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17282617 17282742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17282823 17282927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17283300 17283409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17284447 17284517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17284596 17284668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17285207 17285277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17286652 17286781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17291115 17291235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17292880 17292933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17293843 17294010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17295372 17295462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17296896 17297089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17297210 17297289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17297551 17297670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17299442 17299569 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17300993 17301100 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17302991 17303142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17303285 17303443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17307703 17307830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17308066 17308222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17309306 17309398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17312352 17312471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17315549 17315638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17316962 17317045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17317294 17317375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17318280 17318404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17318483 17318553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17322988 17323070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17325113 17325246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17325394 17325530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17325941 17326049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17348715 17348765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17350762 17350930 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17352738 17352841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17354050 17354233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17354871 17354966 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17356084 17356216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17357546 17357675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17358287 17358387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17358895 17359086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17360497 17360593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17363947 17364012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17367404 17367552 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17373350 17373416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17376918 17377177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17378442 17378514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17381801 17381889 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17386236 17386329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 17389341 17389439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6135 nt):
ATGTGCCCAGTAGATTTTCATGGAATCTTCCAACTAGATGAAAGACGGAGAGATGCAGTGATTGCATTGG
GC
ATTTTTCTCATTGAATCTGATCTTCAGCACAAAGATTGTGTTGTTCCTTATCTTCTTCGACTTCTCAG
G
GGTCTTCCAAAAGTGTATTGGGTAGAAGAAAGCACAGCTCGGAAAGGCAGAGGTAACCTCCCAGTTGCA
GAG
AGCTTCAGCTTCTGCCTGGTGACCTTGCTGTCTGATGTGGCTTGCAGGGACCCCTCACTTAGGGATG
AG
ATTTTAGAGGCAATTTTGCAGGTTTTACATGTCCTTTTGGGAATGTGCCAGGCCTTGGAGATTCAAGA
A
AAAGAATACCTTTGCAAGTATGCGATCCCATGCCTGATAGGAATCTCAAGATCTTTTGGACGTTACAGC
AAT
TCAGAAGAGTCTCTCCTCTCAAAGCTTTTCCCCAAAGTTTCTCCTCATTCCCTGAGAATCCCAGAAG
AG
CTAGAAGGTGTCCGAAGGCGTTCCTTTAATGACTTTCGCTCCATCCTGCCCAGCAACCTGCTAACTGT
C
TGTCAGGAGGGCACACTGAAGAGGAAAACCAGCAGTGTGTCCAGCATCTCTCAGGTTAGCCCAGAACGT
GGC
ATACCCCCTCCCAGCTCCCCTGGAGGATCTGCATTTCACTATTTTGAAGCTTCTTGCCTACCTGATG
GG
ACTGCCTTGGAGCCTGAATACTACTTCTCTACCATCAGCTCCAGTTTTTCTATCTCTCCCCTGTTCAA
T
GGTATTACCTATAAGGAGTTCTGTATTCCACTGGAAATGCTTCGGGAACTCTTAAACTTGGTGAAGAAG
ATT
GTTGAGGAGCCTGTTCTCAAATCCTTAGATGCAATTGTAGCCGGCGTGATGGAGGCCAATCCCAGTG
CT
GATCTGTACTATACAACCTTCAGTGATCCCCTGTACCTGACCATGTTCAAGATGCTTCGAGATACTCT
G
TACTACATGAAAGATCTGCCCACTTCCTTTGTGAAAGAGATCCATGATTTTGTGTTGGAGCAGTTCAAC
ATG
AGCCAAGGGGAGCTCCAAAAGATTCTGCATGACGCAGATAGGATCCACAGTGAGATGAGCCCACTCA
AA
CTGCGCTGCCAAGCAAACGCTGCCTGTGTGGACCTCATGGTGTGGGCTGTGAAGGATGAGCAGGGTGC
A
GAAAACCTTTGCATCAAGCTGTCTGAAAAGCTGCAGTCCAAGACATCCAGTAAGGTCATCATTGCCCAT
TTG
CCCTTGCTGATCTGCTGCCTACAGGGTCTGGGCCGCCTGTGTGAAAGGTTCCCAGTGGTGGTCCACT
CA
GTGACGCCATCTTTGAGAGACTTTCTGGTAATTCCATCCCCAGTGCTGGTGAAGCTCTATAAGTACCA
C
AGTCAGTACCACACAGTTGCTGGCAGTGATATAAAAATCAGTGTCACCAATGAGCATTCCGAGTCAACT
CTG
AATGTCTTGCCGGGCAAGAAGAACCAGCCATCCATGTATGAGCAGCTCCGAGACATCGCCATTGACA
AC
ATCTGCAGGTGCCTGAAGGCCGGCCTCACCGTGGACCCTGTGATCGTGGAGGCCTTCCTGGCCAGCCT
C
TCCAACCGGCTCTACATTTCCCAGGAGAGTGACAAGGATGCTCACTTGATTCCTGACCATACCATCCGT
GCC
TTGGGACACATTGCAGTAGCTTTGAGGGACACTCCAAAGGTCATGGAGCCAATTCTGCAGATCCTGC
AG
CAGAAATTTTGCCAGCCCCCCTCACCCCTTGATGTGCTCATCATCGACCAGCTGGGCTGCCTGGTGAT
C
ACTGGAAATCAATACATTTATCAGGAAGTGTGGAATCTCTTCCAGCAAATCAGTGTAAAGGCCAGTTCA
GTT
GTGTATTCAGCCACCAAAGACTATAAAGACCATGGCTACAGGCACTGCTCCCTAGCAGTGATCAATG
CC
CTGGCCAACATTGCAGCCAACATTCAGGAGGAGCATCTTGTGGACGAGCTGTTGATGAACCTGCTGGA
A
CTGTTTGTGCAGCTGGGGCTGGAGGGGAAAAGAGCCAGTGAGAGGGCCAGTGAAAAGGGGCCTGCCCTG
AAG
GCTTCCAGCAGTGCAGGAAATTTGGGCGTGCTCATTCCTGTAATAGCTGTGCTCACCCGACGATTGC
CA
CCCATCAAAGAAGCTAAACCTAGGCTACAGAAGCTTTTCCGAGATTTCTGGCTCTACTCTGTGCTAAT
G
GGATTCGCTGTGGAAGGCTCAGGACTCTGGCCGGAAGAGTGGTATGAGGGAGTCTGTGAAATAGCTACC
AAG
TCACCTCTGCTTACCTTTCCCAGCAAAGAGCCTCTGCGATCAGTCCTCCAGTACAATTCAGCTATGA
AA
AACGATACGGTCACCCCTGCTGAACTGAGTGAGCTCCGAAGTACCATCATCAACTTGCTAGATCCTCC
T
CCTGAGGTGTCTGCCCTCATCAACAAGCTGGACTTTGCCATGTCTACCTATCTCTTGTCTGTGTATCGG
CTG
GAGTACATGAGGGTACTGCGTTCTACAGATCCAGATCGCTTCCAGGTAATGTTCTGCTACTTTGAGG
AT
AAAGCTATTCAAAAAGACAAATCTGGGATGATGCAGTGTGTCATTGCTGTTGCTGACAAAGTGTTTGA
T
GCTTTCCTGAACATGATGGCAGAAAAAGCTAAGACCAAGGAGAATGAAGAGGAGCTGGAGCGGCATGCA
CAG
TTTCTGCTGGTGAACTTCAACCACATTCATAAGAGGATAAGGAGAGTAGCTGACAAATACCTATCTG
GT
CTGGTGGATAAGTTTCCACACTTGCTCTGGAGCGGGACTGTGCTGAAGACCATGTTGGACATCCTGCA
G
ACCCTGTCACTATCACTAAGTGCTGATATTCACAAGGACCAACCTTACTATGACATTCCTGATGCCCCC
TAT
CGGATCACGGTTCCTGACACATACGAAGCCCGGGAGAGCATCGTGAAAGACTTTGCTGCGCGCTGTG
GA
ATGATCCTACAGGAAGCCATGAAGTGGGCACCCACGGTCACTAAGTCCCACCTACAGGAATATCTGAA
C
AAGCATCAGAACTGGGTGTCAGGACTGTCTCAGCACACAGGATTGGCCATGGCCACTGAGAGCATCCTT
CAT
TTTGCCGGCTACAACAAGCAGAACACAACTCTTGGGGCAACTCAGCTAACTGAGCGTCCGGCCTGTG
TG
AAGAAAGACTACTCCAACTTCATGGCATCCTTGAATTTGCGCAACCGCTATGCCGGCGAGGTACATGG
A
ATGATTCGGTTCTCAGGTGCCACAGGCCAGATGTCTGACCTGAACAAAATGATGGTCCAAGATCTGATC
ACA
GCTTTGGACCACAGTCATCCTCAGCACTATACACAAGCCATGTTCAAATTGACGGCAATGCTCATTA
GC
AGCAAAGATTGTGATCCACAGCTCCTTCATCATCTGTGTTGGGGTCCCCTCCGAATGTTCAATGAGCA
T
GGCATGGAGACTGCACTAGCCTGCTGGGAGTGGCTGCTGGCTGGCAAGAATGGAGTGGAAGTGCCGTTT
ATG
CGGGAGATGGCAGGAGCCTGGCACATGACAGTAGAGCAGAAGTTCGGCCTCTTTTCTGTGGAAACAA
AG
GAAGCAGACCCCCTGGCAGCATCAGAAGCAAGTCAGCCAAGACCTTGTCCCCCCGAAGTGACACCTCA
C
TACATCTGGATCGATTTCCTGGTCCAGCGGTTTGAGATTGCCAAGTACTGTAGCTCTGACCAGGTGGAG
ATC
TTCTCAAGCCTGCTGCAGCGCTCCATGTCCCTCAATATTGGTGGAGCCAGGGGGAGCATGAACAGGC
AT
GTGGCAGCCATTGGACCACGTTTCAAACTGCTGACCTTGGGGCTGTCCCTCCTGCATGCTGATGTGGT
T
CCAAATGCAACCATTCGAAACGTGCTTCGAGAGAAGATATACTCAACAGCCTTTGACTATTTCAGTTGT
CCA
CCAAAGTTTCCTACTCAAGGAGAAAAGAGGCTTCGTGAAGATATAAGCATAATGATTAAGTTTTGGA
CT
GCCATGTTCTCAGATAAGAAGTACCTGACTGCCAGCCAGCTCGTTCCCCCAGATAATCAGGACACCCG
A
AGCAACTTGGATATAACTGTGGGCTCTCGACAACAGGCTACCCAGGGCTGGATCAACACTTACCCCCTC
TCC
AGTGGCATGTCAACCATCTCCAAAAAGTCAGGTATGTCTAAGAAAACCAACCGGGGCTCCCAGCTGC
AC
AAGTACTACATGAAACGCAGGACACTGCTGCTGTCACTATTGGCCACTGAGATCGAACGCCTCATCAC
T
TGGTACAACCCACTGTCAGCCCCAGAGCTAGAGCTGGACCAGGCAGGAGAGAACAGCGTTGCCAACTGG
AGG
TCCAAGTACATCAGCTTGAGTGAGAAGCAGTGGAAGGACAACGTGAACCTTGCCTGGAGCATCTCTC
CA
TACCTCGCTGTGCAGCTGCCAGCCAGGTTCAAGAATACAGAAGCCATTGGAAATGAAGTGACCCGTCT
C
GTTCGCTTGGATCCTGGAGCTGTTAGTGATGTCCCTGAAGCCATCAAGTTCCTTGTCACCTGGCACACC
ATC
GATGCTGATGCTCCAGAGCTCAGCCATGTTTTATGCTGGGCACCCACGGACCCACCTACAGGCCTCT
CC
TACTTCTCCAGCATGTACCCACCACACCCTCTCACTGCACAGTATGGGGTAAAAGTCCTGCGATCCTT
C
CCTCCGGATGCCATTCTGTTCTACATCCCCCAGATTGTGCAGGCCCTCAGATATGACAAGATGGGCTAT
GTG
CGTGAGTACATTCTCTGGGCTGCAGCCAAATCCCAGCTTCTGGCACACCAGTTTATTTGGAACATGA
AA
ACTAACATCTACCTTGATGAAGAAGGGCACCAGAAAGACCCTGACATCGGTGACCTCCTGGAGCAGTT
A
GTAGAAGAGATCACAGGGTCTCTATCAGGCCCAGCCAAAGATTTCTATCAACGGGAATTTGATTTCTTT
AAC
AAGATCACAAACGTGTCAGCCATCATCAAGCCCTACCCTAAAGGCGATGAAAGGAAGAAGGCTTGTC
TG
TCAGCTCTGTCTGAAGTGAAGGTGCAGCCTGGCTGCTACCTGCCCAGCAACCCTGAAGCAATCGTGCT
A
GACATTGACTACAAGTCAGGGACACCAATGCAGAGTGCCGCAAAAGCGCCGTATCTGGCCAAGTTTAAG
GTG
AAGAGATGCGGAGTGAGTGAACTTGAAAAAGAAGGTCTGCAGTGCCGCTCAGACGCAGAGGATGAAT
GC
TTCAGCCAAGAGGCTGATGGCAAGAAGATCTGCTGGCAAGCAGCCATCTTCAAAGTGGGGGATGACTG
C
CGACAGGACATGTTAGCCCTGCAGATCATCGACCTCTTCAAGAACATCTTCCAGCTGGTTGGCCTGGAC
CTC
TTCGTTTTTCCTTATCGGGTAGTGGCTACTGCCCCTGGGTGCGGAGTGATTGAGTGCATCCCAGACT
GT
ACCTCCCGGGACCAGCTGGGCCGCCAGACTGACTTTGGCATGTATGACTACTTTACACGCCAGTATGG
G
GATGAGTCTACCTTGGCCTTCCAGCAGGCACGCTACAACTTTATCAGAAGCATGGCCGCCTATAGCCTC
CTG
CTGTTCCTGCTGCAGATCAAGGACAGGCACAATGGCAACATCATGCTGGACAAGAAGGGGCACATCA
TC
CACATCGACTTTGGCTTCATGTTTGAAAGCTCACCGGGTGGCAACCTTGGCTGGGAACCAGACATCAA
G
CTGACAGACGAGATGGTGATGATTATGGGGGGCAAAATGGAAGCCACACCCTTCAAGTGGTTCATGGAG
ATG
TGTGTCCGAGGTTATCTGGCTGTGCGCCCCTATATGGATGCAGTCGTCTCCCTGGTTACACTCATGT
TG
GACACAGGCCTGCCCTGTTTTCGTGGCCAGACAATCAAACTTTTGAAACACAGGTTCAGCCCGAACAT
G
ACAGAGCGGGAGGCTGCGAATTTTATCATGAAGGTCATCCAGAACTGTTTCCTCAGCAACAGGAGCCGG
ACC
TACGACATGATCCAGTACTACCAGAATGATATCCCCTACTGA


Translation (2044 aa):
MCPVDFHGIFQLDERRRDAVIALGIFLIESDLQHKDCVVPYLLRLLRGLPKVYWVEESTARKGRGNLPVA
E
SFSFCLVTLLSDVACRDPSLRDE
ILEAILQVLHVLLGMCQALEIQEKEYLCKYAIPCLIGISRSFGRYS
N
SEESLLSKLFPKVSPHSLRIPEELEGVRRRSFNDFRSILPSNLLTVCQEGTLKRKTSSVSSISQ
VSPER
G
IPPPSSPGGSAFHYFE
ASCLPDGTALEPEYYFSTISSSFSISPLFNGITYKEFCIPLEMLRELLNLVKK
I
VEEPVLKSLDAIVAGVME
ANPSADLYYTTFSDPLYLTMFKMLRDTLYYMKDLPTSFVKEIHDFVLEQFN
M
SQGELQKILHDADRIHSEMSPLKLRCQANAACVDLMVWAVKDEQ
GAENLCIKLSEKLQSKTSSKVIIAH
L
PLLICCLQ
GLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGSDIKISVTNEHSEST
L
NVLPGKKNQPSMYEQLRDIAIDNIC
RCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIR
A
LGHIAVALRDTPKVMEPILQILQQKFCQPPSPLDVLIIDQLGCLVITGN
QYIYQEVWNLFQQISVKASS
V
VYSATKDYKDHGY
RHCSLAVINALANIAANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPAL
K
ASSSAGNLGVLIPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIAT
K
SPLLTFPSKEPLRSVLQYNSAMKNDTVTP
AELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYR
L
EYM
RVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMAEKAKTKENEEELERHA
Q
FLLVNFNHIHKRIRRVADKYLSGLVD
KFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAP
Y
RITVPDTYEARE
SIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESIL
H
FAGYNKQNTTLG
ATQLTERPACVKKDYSNFMASLNLRNRYAGEVHGMIRFSGATGQMSDLNKMMVQDLI
T
ALDHSHPQHYTQAMFKLTAMLISSK
DCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKNGVEVPF
M
REMAGAWHMTVEQKFGLFSVETKEADPLAASEASQPRPCPPEVTPHYIWID
FLVQRFEIAKYCSSDQVE
I
FSSLLQRSMSLNIGGARGSMNRHVAAIGPRF
KLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSC
P
PKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQLVPP
DNQDTRSNLDITVGSRQQATQGWINTYPL
S
SGMSTISKKS
GMSKKTNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANW
R
SKYISLSEKQWKDNVNLAWSISPYLAVQLPA
RFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHT
I
DADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPP
DAILFYIPQIVQALRYDKMGY
V
REYILWAAAKSQLLAHQFIWNMKTNIYLDEEGHQKD
PDIGDLLEQLVEEITGSLSGPAKDFYQREFDFF
N
KITNVSAII
KPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFK
V
KRCGVSELEKE
GLQCRSDAEDECFSQEADGKKICWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLD
L
FVFPYRVVATAPG
CGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSL
L
LFLLQIKDRHNGNIMLDKKGHIIHI
DFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFME
M
CVRGYLAV
RPYMDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQNCFLSNRSR
T
YDMIQYYQNDIPY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser