NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37180.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37180.1 Public Mus musculus 15 Lrrk2 21 106 86 CCDS HistoryNCBI Gene:66725Re-query CCDS DB by CCDS ID:37180.1Re-query CCDS DB by GeneID:66725See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37180.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060642 ENSMUSP00000052584 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060642Link to Ensembl Protein Viewer:ENSMUSP00000052584Re-query CCDS DB by Nucleotide ID:ENSMUST00000060642Re-query CCDS DB by Protein ID:ENSMUSP00000052584
Original member Current member EBI,WTSI OTTMUST00000049323 OTTMUSP00000022827 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049323Link to Vega Protein Viewer:OTTMUSP00000022827Re-query CCDS DB by Nucleotide ID:OTTMUST00000049323Re-query CCDS DB by Protein ID:OTTMUSP00000022827
Original member Current member NCBI NM_025730.3 NP_080006.3 Accepted alive Link to Nucleotide Sequence:NM_025730.3Link to Protein Sequence:NP_080006.3Re-query CCDS DB by Nucleotide ID:NM_025730Re-query CCDS DB by Protein ID:NP_080006Link to BLink:NP_080006.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080006.3 2527 Q5S006 2527 100% 0 0

Chromosomal Locations for CCDS 37180.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 91673281 91673437 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91673620 91673705 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91679778 91679887 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91683093 91683181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91685732 91685866 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91688828 91688962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91696278 91696409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91699883 91700002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91700346 91700488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91700577 91700656 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91702170 91702276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91705106 91705235 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91709264 91709388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91712756 91712862 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91723092 91723236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91723766 91723905 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91725933 91726061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91726137 91726307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91728916 91729174 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91731465 91731653 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91733989 91734107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91736587 91736656 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91737103 91737320 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91738725 91738975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91739262 91739410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91742251 91742344 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91745698 91745884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91747652 91747833 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91749661 91749890 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91750224 91750351 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91752142 91752360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91755790 91755991 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91756980 91757068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91764632 91764819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91765677 91765831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91767313 91767459 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91772822 91773013 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91774896 91775042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91778426 91778526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91779819 91780009 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91786966 91787126 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91795997 91796167 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91797422 91797522 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91801839 91802033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91803286 91803479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91804897 91804969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91806743 91806927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91810992 91811144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91812192 91812400 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91814662 91814733 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 91815414 91815535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7584 nt):
ATGGCCAGTGGCGCCTGTCAGGGCTGCGAAGAGGAAGAGGAGGAGGAGGCTCTGAAGAAGTTGATAGTCA
GG
CTGAATAATGTCCAGGAAGGCAAGCAGATCGAGACGTTGCTTCAGCTCCTGGAGGACATGCTGGTGTT
C
ACCTACTCGGACCGCGCCTCCAAGTTATTTGAAGATAAAAATTTCCACGTGCCTCTGTTGATTGTCCTG
GAC
TCCTACATGAGAGTTGCCAGTGTACAGCAGGCGGGGTGGTCACTTCTGTGCAAATTAATAGAAGTCT
GT
CCAGGGACATTGCAAAGCTTAATAGGACCCCAGGATATTGGAAATGATTGGGAAGTCCTTGGTATTCA
C
CGGCTGATTCTTAAAATGTTAACTGTTCATCACGCCAATGTAAACCTGTCAATAGTTGGACTAAAAGCC
TTG
GATCTCCTCCTAGATTCAGGTAAACTCACCTTGCTGATACTGGATGAAGAATGTGATATTTTCTTGT
TA
ATTTTTGATGCCATGCACAGATATTCAGCCAATGATGAAGTCCAAAAACTGGGATGCAAAGCTTTACA
C
GTGCTTTTTGAGAGAGTTTCCGAGGAACAGCTGACTGAGTTTGTGGAGAACAAAGATTACACGATACTG
CTG
AGTACGTTCGGCAGCTTCAGAAGGGACAAGGAGATTGTGTACCACGTACTTTGCTGCTTGCATTCCC
TG
GCGGTTACATGCAGCAATGTAGAGGTCCTCATGAGTGGGAATGTCCGGTGCTACAATCTTGTGGTGGA
G
GCCATGAAAGCCTTCCCCACCAATGAAAACATCCAAGAGGTGAGCTGCTCCTTGTTCCAGAAGCTTACA
TTA
GGTAACTTTTTCAACATCCTGGTGTTGAACGAAGTGCATGTCTTTGTGGTGAAAGCGGTCCGACAGT
AT
CCTGAGAACGCAGCCTTACAGATCTCTGCACTCAGCTGTTTAGCACTCCTCACTGAGACTATTTTCTT
A
AACCAAGACTTGGAGGAAAGAAGTGAGACTCAAGAGCAGAGCGAAGAGGAAGACAGTGAGAAGCTTTTC
TGG
CTGGAACCCTGCTATAAAGCCCTGGTGCGCCATCGAAAGGACAAACACGTGCAGGAGGCTGCCTGCT
GG
GCACTAAATAACCTCCTTATGTACCAGAACAGTTTGCATGAGAAGATCGGAGATGAAGATGGCCAGTT
C
CCTGCGCACAGGGAAGTGATGCTGTCTATGCTGATGCACTCTTCTTCCAAAGATGTCTTCCAAGCAGCT
GCA
CATGCTCTGTCCACTCTCTTGGAACAAAATGTTAATTTCAGGAAAATCCTGCTGGCAAAAGGAGTAT
AC
CTGAATGTCTTGGAATTGATGCAGAAGCATGCCCATGCGCCTGAGGTGGCAGAGAGTGGCTGCAAGAT
G
CTGAGTCACCTGTTTGAAGGAAGTAACCCTTCTCTGGATACAATGGCAGCAGTGGTCCCTAAAATACTA
ACA
GTGATGAAAGCCCACGGAACGTCTCTGTCAGTCCAGCTGGAGGCGCTGCGAGCTATCTTGCATTTCG
TT
GTGCCAGGACTATTGGAAGAATCCAGGGAGGACTCTCAATGCAGACCAAATGTGCTCAGAAAACAGTG
T
TTCAGGACTGACATCCACAAGCTGGTTCTAGTCGCTCTGAACAGGTTCATTGGGAATCCTGGGATTCAG
AAA
TGTGGATTGAAAGTAATCTCTTCTCTCGCGCACCTTCCTGATGCCACAGAGACATTGTCCCTGCAAG
GA
GCAGTTGACTCAGTCCTCCACACCTTACAGATGTATCCAGATGACCAAGAAATTCAGTGTCTGGGCTT
A
CACCTTATGGGATGCTTGATGACAAAGAAGAATTTCTGCATAGGGACAGGGCACCTCCTGGCAAAAATT
CTG
GCTTCCACTTTGCAGCGCTTTAAAGATGTTGCTGAGGTGCAGACTACAGGATTACAGACAACCCTGT
CA
ATACTTGAGCTGTCAGTATCTTTCTCCAAGCTGCTAGTGCACTATTCCTTTGATGTGGTGATATTTCA
T
CAGATGTCTTCCAGTGTTGTAGAACAAAAGGATGAGCAGTTCCTCAATCTATGTTGCAAATGCTTTGCA
AAA
GTGGCCGTGGATGATGAGCTGAAAAACACCATGCTAGAGAGAGCCTGCGATCAGAATAACAGCATCA
TG
GTTGAATGTTTGCTCCTCTTGGGAGCTGATGCCAACCAAGTGAAGGGGGCAACTTCTTTAATCTATCA
G
GTATGTGAGAAAGAGAGCAGTCCTAAATTGGTGGAACTGTTGCTTAATGGTGGTTGTCGTGAACAAGAT
GTA
CGGAAGGCCCTGACCGTAAGCATCCAAAAGGGCGACAGCCAGGTCATCAGCTTGCTCCTCAGGAAAC
TT
GCCCTGGACCTGGCCAACAACAGCATTTGCCTTGGAGGATTTGGCATAGGAAAAATTGATCCTTCTTG
G
CTTGGTCCTTTATTTCCAGATAAGTCATCCAATTTAAGGAAGCAAACAAACACAGGATCTGTCCTAGCG
AGG
AAAGTGCTCCGGTATCAGATGAGAAACACCCTTCAAGAAGGCGTGGCCTCAGGCAGTGACGGCAAGT
TT
TCTGAAGACGCGCTGGCGAAATTTGGAGAATGGACCTTTATTCCCGACTCTTCTATGGACAGTGTGTT
T
GGCCAGAGCGATGATCTGGATAGCGAAGGCAGCGAGAGCTCATTTCTCGTGAAGAGGAAGTCCAACTCA
ATT
AGTGTAGGGGAAGTTTACAGAGATCTAGCTCTGCAGCGCTGCTCACCAAATGCTCAGAGGCATTCCA
AT
TCGCTGGGTCCTGTTTTTGACCATGAAGACTTACTGAGACGAAAAAGAAAAATACTGTCTTCAGATGA
G
TCTCTCAGGTCCTCAAGGCTGCCGTCCCATATGAGGCAATCAGATAGCTCTTCTTCCCTGGCTTCTGAG
AGA
GAACACATCACGTCGTTAGACCTATCTGCCAACGAACTCAAAGATATTGATGCTCTGAGCCAGAAGT
GT
TGCCTCAGTAGCCACCTGGAACATCTCACCAAACTGGAACTTCACCAGAATTCACTCACGAGCTTCCC
A
CAGCAGCTGTGTGAGACTCTGAAGTGTTTGATACACTTGGATTTGCACAGTAACAAATTCACCTCATTT
CCC
TCTTTCGTGTTGAAAATGCCACGTATCACCAACCTAGATGCCTCTCGAAATGACATCGGGCCAACAG
TA
GTTTTAGACCCTGCGATGAAGTGTCCAAGCCTCAAACAGTTGAATCTGTCCTATAACCAGCTCTCTTC
A
ATCCCAGAGAATCTTGCCCAAGTGGTGGAGAAACTTGAGCAGCTCCTACTGGAAGGAAATAAAATATCC
GGG
ATTTGCTCTCCCCTGAGCCTGAAGGAACTGAAGATTTTAAATCTTAGTAAAAATCACATTCCATCCC
TA
CCTGGAGATTTTCTTGAGGCTTGTTCAAAAGTCGAGAGTTTCAGTGCTCGCATGAATTTTCTTGCTGC
A
ATGCCTGCCTTACCTTCTTCCATAACGAGCTTAAAATTGTCTCAGAACTCTTTCACGTGCATTCCAGAA
GCG
ATTTTCAGTCTTCCGCACTTGCGGTCCTTGGATATGAGCCACAACAACATTGAATGTCTGCCGGGAC
CT
GCACATTGGAAGTCTCTGAACTTAAGGGAACTCATTTTTAGCAAGAATCAGATCAGCACCTTAGACTT
T
AGTGAGAACCCACACGTGTGGTCAAGAGTAGAGAAACTGCATCTCTCTCATAATAAACTGAAAGAGATT
CCT
CCAGAAATTGGCTGCCTTGAAAATCTGACGTCTCTCGACGTCAGTTACAACTTGGAACTGAGGTCCT
TC
CCAAATGAAATGGGGAAGTTGAGCAAGATATGGGATCTTCCCTTGGACGGACTGCATCTGAATTTTGA
C
TTTAAGCACGTAGGATGCAAGGCCAAAGACATCATAAGGTTTCTACAACAACGTCTGAAAAAGGCTGTA
CCC
TACAACCGAATGAAGCTCATGATTGTGGGAAATACGGGGAGCGGTAAGACCACTTTACTGCAACAAC
TC
ATGAAAATGAAGAAACCAGAACTTGGCATGCAGGGTGCCACAGTCGGCATAGACGTGCGAGACTGGTC
C
ATCCAAATACGGGGCAAAAGGAGAAAGGACCTGGTTCTAAACGTGTGGGATTTTGCAGGTCGTGAGGAA
TTC
TACAGCACTCACCCCCACTTCATGACCCAGAGAGCCCTCTACCTGGCTGTCTATGATCTCAGCAAGG
GG
CAGGCAGAGGTGGACGCCATGAAGCCCTGGCTCTTCAATATCAAGGCTCGTGCCTCTTCTTCCCCGGT
G
ATTCTGGTGGGCACACATTTGGATGTTTCTGATGAGAAGCAGCGGAAAGCGTGCATAAGCAAAATCACG
AAG
GAACTCCTAAATAAGCGAGGATTCCCCACCATCCGGGACTACCACTTTGTGAATGCCACCGAGGAGT
CA
GATGCGCTGGCAAAGCTTCGGAAAACCATCATAAATGAGAGCCTTAATTTCAAGATCCGAGATCAGCC
T
GTGGTTGGGCAGCTAATTCCAGATTGCTACGTAGAACTGGAGAAAATCATTTTATCAGAGCGGAAAGCT
GTG
CCGACTGAGTTTCCTGTGATTAACCGGAAACACCTGTTACAGCTCGTGAACGAACATCAGCTGCAGC
TG
GATGAGAACGAGCTCCCACACGCCGTTCACTTCCTAAATGAGTCGGGAGTTCTTCTGCATTTTCAAGA
C
CCTGCCCTGCAGCTAAGTGACCTGTACTTTGTGGAACCCAAGTGGCTTTGTAAAGTCATGGCACAGATC
TTG
ACAGTGAAGGTAGACGGCTGTCTGAAACATCCTAAGGGCATCATTTCCCGGAGAGATGTGGAAAAAT
TC
CTTTCAAAGAAGAAGCGATTCCCGAAGAACTATATGATGCAATACTTTAAACTATTAGAAAAATTTCA
G
ATCGCATTGCCAATAGGGGAAGAATATCTTCTGGTTCCAAGCAGCTTGTCTGACCACAGGCCAGTGATA
GAG
CTCCCCCACTGTGAGAACTCTGAGATCATCATCCGGCTGTACGAAATGCCGTACTTTCCCATGGGAT
TT
TGGTCAAGATTGATTAACCGATTACTTGAAATCTCACCCTTCATGCTTTCTGGCAGAGAGAGAGCACT
A
CGCCCTAACAGGATGTATTGGCGGCAAGGCATCTACTTGAATTGGTCTCCAGAAGCATACTGTCTGGTA
GGC
TCTGAAGTCTTAGACAATCGACCTGAGAGTTTCTTGAAAATCACAGTTCCGTCTTGTAGAAAAGGTT
GT
ATTCTTCTGGGCCGAGTTGTGGATCATATTGACTCACTCATGGAAGAATGGTTTCCCGGGTTACTGGA
G
ATTGACATTTGTGGGGAAGGAGAAACTCTGTTGAAGAAATGGGCATTGTACAGTTTTAATGATGGTGAA
GAA
CATCAGAAGATCTTGCTTGATGAGTTGATGAAGAAGGCTGAAGAAGGAGACCTGTTAATAAATCCAG
AC
CAACCAAGGCTCACTATTCCAATATCCCAGATTGCTCCGGACTTGATCTTGGCTGACCTGCCTAGAAA
T
ATCATGTTGAACAATGATGAGTTGGAATTTGAGGAAGCACCAGAGTTTCTCTTAGGCGATGGAAGTTTT
GGA
TCCGTTTATCGAGCTGCCTACGAAGGAGAGGAAGTGGCTGTGAAGATTTTTAATAAGCACACATCTC
TT
AGGCTGTTAAGACAAGAGTTGGTGGTCCTTTGTCACCTTCACCACCCCAGCCTGATATCCTTGCTGGC
G
GCTGGTATTCGTCCTCGGATGTTGGTAATGGAGTTGGCCTCCAAAGGTTCCTTGGATCGCCTGCTGCAG
CAG
GACAAAGCCAGCCTCACCAGAACCCTCCAGCACAGGATCGCGTTGCATGTGGCCGACGGCCTGAGGT
AT
CTCCACTCAGCCATGATTATTTACCGTGACCTGAAGCCCCACAATGTGCTGCTTTTTACCCTGTATCC
C
AATGCTGCCATCATTGCGAAGATTGCGGACTACGGGATCGCACAGTACTGCTGCAGGATGGGAATAAAG
ACA
TCAGAGGGCACCCCAGGGTTCCGGGCACCTGAAGTTGCCAGGGGGAATGTCATTTATAACCAACAGG
CC
GATGTTTATTCTTTTGGCTTACTACTTCACGATATTTGGACAACTGGGAGTAGGATTATGGAGGGTTT
G
AGGTTCCCAAATGAGTTTGATGAGTTAGCCATACAAGGGAAGTTGCCAGATCCAGTTAAAGAATATGGC
TGT
GCCCCATGGCCTATGGTTGAGAAGTTAATTACAAAGTGTTTGAAAGAAAATCCTCAAGAAAGACCCA
CT
TCTGCCCAGGTCTTTGACATTTTGAATTCGGCTGAATTAATTTGCCTCATGCGACACATTTTAATACC
T
AAGAACATCATTGTTGAATGCATGGTTGCCACGAATCTCAATAGCAAGAGTGCGACTCTCTGGTTGGGA
TGT
GGGAACACAGAAAAAGGACAGCTTTCCTTATTTGACTTAAACACGGAAAGATACAGCTATGAGGAAG
TT
GCTGATAGTAGAATACTGTGCTTGGCTTTGGTGCATCTCGCTGCTGAGAAAGAGAGCTGGGTTGTGTG
C
GGGACACAGTCTGGGGCTCTCCTGGTCATCAATGTTGAAGAGGAGACAAAGAGACACACCCTGGAAAAG
ATG
ACTGATTCTGTCACTTGTTTGCATTGCAATTCCCTTGCCAAGCAGAGCAAGCAAAGTAACTTTCTTT
TG
GTGGGAACTGCTGATGGTAACTTAATGATATTTGAAGATAAAGCCGTTAAGTGTAAAGGAGCTGCCCC
C
TTGAAGACACTACACATAGGCGATGTCAGTACGCCCCTGATGTGCCTGAGCGAGTCCCTGAATTCATCT
GAA
AGACACATCACATGGGGAGGGTGTGGCACAAAGGTCTTCTCCTTTTCCAATGATTTCACCATTCAGA
AA
CTCATCGAGACAAAAACCAACCAGCTGTTTTCTTACGCAGCTTTCAGCGATTCTAACATCATAGCGCT
G
GCAGTAGACACAGCCCTGTATATTGCCAAGAAAAACAGCCCTGTCGTAGAGGTGTGGGACAAGAAAACA
GAA
AAGCTCTGTGAATTAATAGACTGTGTGCACTTCTTAAAGGAGGTGATGGTAAAACTAAACAAGGAAT
CG
AAACATCAGCTGTCCTACTCTGGGAGGGTGAAGGCCCTCTGCCTGCAGAAGAACACGGCTCTCTGGAT
C
GGAACTGGAGGAGGCCACATCTTACTCCTGGATCTTTCTACTCGGCGAGTTATCCGCACCATTCACAAT
TTC
TGTGATTCTGTGAGAGCCATGGCCACAGCACAATTAGGAAGCCTTAAGAATGTCATGCTGGTTTTGG
GG
TACAAGCGGAAGAGTACAGAGGGTATCCAAGAACAAAAAGAGATACAATCTTGTTTGTCTATTTGGGA
C
CTCAATCTTCCACACGAGGTGCAAAATTTAGAAAAACACATTGAAGTAAGAACAGAATTAGCTGATAAA
ATG
AGGAAAACATCTGTTGAATAG


Translation (2527 aa):
MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDMLVFTYSDRASKLFEDKNFHVPLLIVL
D
SYMRVASVQQ
AGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKA
L
DLLLDS
GKLTLLILDEECDIFLLIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTIL
L
STFGSFRRDKEIVYHVLCCLHSLAVT
CSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLT
L
GNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQSEEEDSEKLF
W
LEPCYKALVRHRKDKHVQ
EAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAA
A
HALSTLLEQN
VNFRKILLAKGVYLNVLELMQKHAHAPEVAESGCKMLSHLFEGSNPSLDTMAAVVPKIL
T
VMKAHGTSLSVQLEALRAILHFVVP
GLLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQ
K
CGLKVISSLAHLPDATETLSLQGAVDSVLHTLQMYPDDQ
EIQCLGLHLMGCLMTKKNFCIGTGHLLAKI
L
ASTLQRFKDVAEVQTT
GLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNLCCKCFA
K
VAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQ
VCEKESSPKLVELLLNGGCREQD
V
RKALTVSIQKGDSQVISLLLRKLALDLANNSICLGGFGIGKIDPSWLGPLFPDKSSNLRKQT
NTGSVLA
R
KVLRYQMRNTLQEGVASGSDGKFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSE
GSESSFLVKRKSNS
I
SVGEVYRDLALQRCSPNAQRHSNSL
GPVFDHEDLLRRKRKILSSDESLRSSRLPSHMRQSDSSSSLASE
R
EHITSLDLSANELKDIDALSQKCCLSSHLEHLTKLELHQNSLTSFPQQLCE
TLKCLIHLDLHSNKFTSF
P
SFVLKMPRITNLDASRNDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLE
GNKIS
G
ICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFL
AAMPALPSSITSLKLSQNSFTCIPE
A
IFSLP
HLRSLDMSHNNIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEI
P
PEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDII
RFLQQRLKKAV
P
YNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFA
GREE
F
YSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIK
ARASSSPVILVGTHLDVSDEKQRKACISKIT
K
ELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFK
IRDQPVVGQLIPDCYVELEKIILSERKA
V
PTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNES
GVLLHFQDPALQLSDLYFVEPKWLCKVMAQI
L
TVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPS
SLSDHRPVI
E
LPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGR
ERALRPNRMYWRQGIYLNWSPEAYCLV
G
SEVLDNRPESFLKITVPSCRK
GCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGE
E
HQKILLDELMKKAEE
GDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSF
G
SVYRAAYEGEEVAVKIFNKHTSLRLLRQ
ELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQ
Q
DKASLTRTLQHRIALHVADGL
RYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIK
T
SEGTP
GFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYG
C
APWPMVEKLITKCLKENPQERPTSAQ
VFDILNSAELICLMRHILIPKNIIVECMVATNLNSKSATLWLG
C
GNTEKGQLSLFDLNTERYSYE
EVADSRILCLALVHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEK
M
TDSVTCLHCNSLAKQ
SKQSNFLLVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLSESLNSS
E
RHITWGGCGTKVFSFSNDFTIQKLIETKTNQ
LFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKT
E
KLCELIDCVHFL
KEVMVKLNKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHN
F
CDSVRAMATAQL
GSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADK
M
RKTSVE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser