NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36954.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36954.1 Public Mus musculus 14 Kif13b 21 106 86 CCDS HistoryNCBI Gene:16554Re-query CCDS DB by CCDS ID:36954.1Re-query CCDS DB by GeneID:16554See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 36954.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000100473 ENSMUSP00000098041 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000100473Link to Ensembl Protein Viewer:ENSMUSP00000098041Re-query CCDS DB by Nucleotide ID:ENSMUST00000100473Re-query CCDS DB by Protein ID:ENSMUSP00000098041
Original member NCBI NM_001081177.1 NP_001074646.1 Updated not alive Link to Nucleotide Sequence:NM_001081177.1Link to Protein Sequence:NP_001074646.1Re-query CCDS DB by Nucleotide ID:NM_001081177Re-query CCDS DB by Protein ID:NP_001074646
Current member NCBI NM_001081177.2 NP_001074646.1 Accepted alive Link to Nucleotide Sequence:NM_001081177.2Link to Protein Sequence:NP_001074646.1Re-query CCDS DB by Nucleotide ID:NM_001081177Re-query CCDS DB by Protein ID:NP_001074646Link to BLAST:NP_001074646.1

Chromosomal Locations for CCDS 36954.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 64652602 64652656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64669624 64669717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64708492 64708504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64714074 64714134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64715388 64715480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64717474 64717654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64722307 64722394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64724700 64724834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64727074 64727186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64728213 64728324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64736148 64736360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64737495 64737605 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64738507 64738641 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64742307 64742437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64744876 64744962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64746299 64746489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64746929 64747139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64748446 64748608 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64750213 64750359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64751506 64751655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64751968 64752096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64757414 64757584 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64758551 64758708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64760669 64760801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64765003 64765149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64765711 64765740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64767354 64767453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64767613 64767739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64768420 64768475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64770542 64770663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64772911 64773087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64776237 64776329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64779314 64779466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64779691 64779768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64782342 64782395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64788408 64788519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64789565 64789698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64800345 64800446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64803025 64803730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 64806031 64806296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5532 nt):
ATGGGAGACTCCAAAGTGAAAGTGGCGGTACGGGTCCGGCCAATGAACCGACGAGAAATTGACTTACATA
CC
AAATGTGTGGTGGATGTTGAAGCGAACAAAGTTATTCTGAATCCTGTAAATACAAATCTTTCCAAAGG
A
GATGCCCGGGGCCAGCCAAAGATCTTTGCTTATGATCACTGTTTCTGGTCCATGGATGAATCTGTCCGA
GAG
AAGTATGCAGGTCAAGAAGATGTTTTCAAGTGCCTTGGGGAGAACATTCTTCAGAATGCATTTGATG
GC
TACAACGCCTGTATCTTTGCTTATGGGCAGACAGGGTCTGGAAAGTCTTACACCATGATGGGCACTGC
T
GACCAACCTGGATTAATCCCAAGGCTCTGTAGTGGACTCTTTGAACGAACCCAGAAAGAGGAAAATGAA
GAA
CAGAGTTTTAAAGTCGAAGTGTCGTACATGGAAATTTATAATGAAAAAGTCCGAGACCTTCTTGACC
CC
AAAGGAAGCCGTCAGACGTTGAAAGTGAGAGAGCACAGTGTGTTGGGACCCTACGTGGATGGACTTTC
T
AAACTGGCTGTCACAAGCTACAAGGATATTGAGTCTCTGATGTCTGAGGGCAACAAGTCTCGGACAGTT
GCT
GCAACCAACATGAACGAGGAAAGTAGCCGTTCCCATGCAGTCTTCAAAATCACCCTGACACATACTC
TG
TATGATGTGAAGTCTGGGACATCTGGAGAGAAAGTGGGCAAGCTGAGCTTAGTGGATTTAGCTGGCAG
T
GAACGAGCCACGAAAACCGGAGCTGCGGGCGACAGGCTGAAGGAGGGCAGCAACATCAACAAGTCCCTC
ACA
ACCCTGGGTCTGGTTATCTCTGCCCTAGCTGATCAGGGTGCTGGCAAAAACAAAAATAAATTTGTTC
CC
TATCGGGACTCAGTTCTCACATGGCTGCTCAAGGACAGTCTGGGAGGTAATAGCAAGACTGCCATGGT
G
GCCACTGTGAGCCCCGCTGCAGATAACTATGACGAAACCCTCTCAACCCTGAGGTACGCAGATCGAGCA
AAG
CACATCGTCAACCATGCTGTGGTGAATGAGGATCCGAATGCTCGGATTATCCGAGATCTGCGGGAGG
AG
GTGGAGAAGCTCCGGGAGCAGCTGACCAAGGCAGAGGCAATGAAATCTCCAGAGCTGAAAGATCGTCT
G
GAAGAATCGGAGAAACTCATCCAGGAAATGACTGTGACCTGGGAGGAGAAACTAAGGAAAACTGAGGAG
ATT
GCGCAGGAGCGGCAAAAGCAGCTTGAGAGCCTTGGCATATCTCTTCAGACTTCTGGAATCAAGGTTG
GG
GATGACAAGTGCTTCCTGGTTAACCTGAATGCTGACCCAGCTCTGAATGAACTCCTGGTGTACTACTT
A
AAGGAGCACACGCTGATAGGGTCGGCCAATTCTCAGGACATCCAGCTCTGCGGGATGGGCATCCTCCCT
GAG
CACGGCATCATAGACATCACGCCCGAGGGCCAGGTTGTGCTGACTCCTCAGAAGAACACCAGAACAT
TT
GTCAATGGGTCTTCTGTCTCCAGCCCCATCCAGCTGCACCATGGGGACAGGATACTGTGGGGAAACAA
C
CATTTCTTCAGACTCAATCTGCCAAAAAAGAAAAAGAAAGCAGAGCGAGAGGACGAGGACCGTGAGGCA
TCC
CTGAAAAACGACAGTAGTTCTGAGCAGCTGGATGCCGACGGCGACTCCTCCAGTGAGGTGTCCAGCG
AG
ATCAACTTCAACTTTGAGTATGCACAGATGGAGGTGACCATGAAGGCTCTGGGCAGCAATGACCCAAT
G
CAGTCCATACTGAGCAGCCTAGAACAGCAGCATGAGGAGGAGAAGCGGTCTGCTCTGGAGCGCCAGAGG
CTC
ATGTACGAACACGAACTGGAACAGCTTCGAAGAAGGCTGTCTCCTGAGAGGCAGAACTGCCGCGGTG
TG
GACCGGCTCTCCTTCCACTCGCCCAGTGCCCAGCAGCGCTTGAAACAGTGGGCTGAAGAGAGAGAAGC
A
ACATTGAATAACAGCTTGATGAGGCTGAGGGAGCAGATTGTAAAGGCCAACCTGCTGGTTCGGGAAGCT
AGT
TACATCGCAGAAGAGTTGGATAAAAGAACCGAGTATAAAGTTACCCTCCAGATTCCAACCTCCAGTC
TG
GATGCCAATAGGAAGCGAGGCTCTCTCCTCAGTGAACCTGCCATCCAGGTGAGAAGAAAGGGCAAAGG
A
AAGCAGATTTGGTCTTTGGAAAAGCTGGAAAACAGGCTTTTGGATATGAGAGACCTCTACCAGGAGTGG
AAG
GAGTGTGAAGAAGACAGCCCGGTTAGCCGGTCCTACTTCAAGCGTGCTGACCCATTCTATGATGAGC
AG
GAAAACCATAGTCTCATCGGTGTGGCCAATGTCTTCCTGGAGACCCTGTTTTATGACGTGAAGTTACA
G
TATGCTGTGCCGATCATCAACCAGAAGGGAGAGGTGGCAGGCCGGCTGCACGTGGAGGTGATGCGACTC
AGT
GGGGCTATTGGGGAGAGGATTGCAGGAGGAGACGATCCTACAGAGGTCAGCTCTGAAAAGGAAGCCC
AG
GAGAACAGGCTGGTCTGCATGGTTAAAATACTCCAAGCCACAGGGTTGCCGCAGCATCTGTGTCACTT
T
GTCTTCTGCAAATATGACTTCTGGGATCAGCAGGAGCCAGTGACCGTTGCCCCTGAAGTGGATACGTCT
TCG
TCTCCCACCAGCAAGCAGCCACAGTGTATGGTTGTGTTCGATCACTGCAGTGAGTTCAGTGTTAACA
TC
ACAGAAGACTTCATTGAATATCTCTCAGAAGGGGCCCTAGCCATTGAAGTATATGGACATAAAATGAA
T
GATCCCCGGAAAAACCCAGCCCTGTGGGACTTGGGGATCATCCAAGCAAAAACAAGGAGTCTTCGGGAC
AG
G
TGGAGTGAAGTCACCAGAAAGTTGGAATTCTGGGTTCAGATCTTGGAACAGAATGAGAATGGTGATT
AC
TGTCCGGTGGAAGTAATTGCTGCAAAAGATGTCCCCACAGGAGGGATCTTCCAGCTCCGACAGGGGCA
G
TCTCGGCGAGTTCAAGTTGAAGTGAAGTCTGTGCAGGAGTCAGGAACTTTACCACTGATGGAAGAGTGC
ATA
TTGTCAGTTGGCATTGGGTGTGTGAAAGTTAGGCCACTCCGGTCCCCTAAGATCCACGAGAATGTCC
AT
GAGGAAGAGGAGGACATGGACAGCTACCAGGATAGGGATTTAGAGCGGCTTCGTAGAAAATGGCTCAA
T
GCATTAACCAAACGTCAAGAATACTTGGATCAACAACTGCAGAAGCTTGTCAGTAAACATGACAAAACT
GAG
GATGATGCTGACCGAGAGGCACAGCTCCTGGAGATGCGGCTGACGCTCACAGAGGAAAGAAATGCAG
TG
ATGGTGCCTTCTGCTGGGAGTGGCATTCCAGGGGCCCCTGCAGAATGGACCCCAGTGCCTGGGATGGA
G
ACCCACATTCCTGTTATATTTCTTGACTTAAATGCGGATGATTTCAGCTCTCAGGATAATCTCGATGAC
CCA
GAAGCAGGATGGGATGCTACCCTGACTGGGGAAGAGGAGGAGGAGTTCTTTGAGCTGCAGATTGTGA
AA
CAACACGATGGAGAGGTGAAGGCAGAGGCCTCCTGGGACTCTGCAGTGCACAGCTGTCCTCAACTCAG
T
AAGGGCACACCTGCTGACGAGCGAGTGTTCCTCATCCTGCGAGTGACTGTCCAGCTCAGCCATCCTGCC
GAC
ATGCAGCTGGTCCTACGCAAGAGGATTTGTGTCCATGTTCATGGGCGCCAGGGCTTTGCTCAAAGTC
TC
CTCAAAAAGATGTCTCACCGGAGCTCTATTCCTGGCTGTGGAGTGACCTTTGAAATCGTCTCCAATAT
T
CCAGAGGATGCCCAGGGAGTGGAGGAGCGAGAGGCACTGGCAAGGATGGCAGCTAACGTGGAAAACCCA
GCA
TCTGCTGACTCCGAGGCCTATATTGAGAAGTACTTGAGGAGTGTGCTGGCCGTGGAAAACCTCCTGA
CT
TTAGATCGCCTGCGTCAGGAAGTGGCCGTGAAGGAGCAGCTGACGGGGAAGGGGAAGCTGAGCCGAAG
G
AGTATCAGCTCCCCCAGCATGAACAGATTGTCAGGAAGCCGGCAGGAGCTTAGCCCATCCCACAGTCTA
GGC
AGCAACAAGGGCCGGTGGGAAAGTCAACAGGATGTGTCCCAAACACTAGTTTCCAGAGGAATAGCTC
CA
GGCCCTCCAGCTCTCTCTGTTTCGCCCCAAAATAACCAGTCTCCTGATCCTGGACTGGGAGGCGTGGC
A
GCCTCTTACTTGAACCCAGTGAAGTCCCTGGTGCCACAGATGCCAAAGCTGCTGAAGTCTCTCTTCCCT
GTT
CGGGATGACAGAAGGGGGAGACACTCATCTCCCCTTGCACACCAGCCCGTGCCCCGAATCTTGGTGC
AG
CCTACCTTCTCAGATACCTGGGCAACAAGGACAGAGGAGGTGAGTCACCAGGTTGGGGCTGCCCCACT
T
GCAGAGGTGATGGCGGCCCCTGCAGTAAAGATCTGTGACAAACCTGTCAAAGTGTCTTCCCCTCCATCT
CCC
ATGGTGGTTACTCAGCCCCCAGAAGGACAGGATGGACCACCCAGCCCTTTGAGTGAAGCTTCAAGTG
GC
TACTTCTCTCACAGTGTCTCTTCTGCCACCCTGTCAGAAACACTCACCTTAGGCCTGGACACCACAGG
C
CTCGGCAGCCAGACGCCTGGGTCCCCCCCTGCCCTGTGTCAGGTCACCCCAGAGCCTGAGCTGGCTTTC
CTC
TCCTGCACACAAAGCCATCCTCCTGCCCCAGAGGAGGCCCACGTACCTGCAGCTCCTACTCAAAGCA
CA
GAGCTGGAGGTTCCCAGAGCACCTCTTCTTTCTGAACCCGCGTCTGCTGTACCCACGTCCCCATTCAG
A
ATCCGGAAAGTGCGGACCTCAGAGCTTAAGTCCTTCACAGGCATGCTGGGTGGTGCCTCCTCCGGAGCA
GAG
GAGGACCCCCTGGCTTCAGAAGACCCCAGCAATGCTAGGGGACAGACTCTGGGGAGGCTAGAAGTAA
CA
TCTGACTCTGAGGATGCCAGCGAAGTCCCTGAGTGGCTCAGAGAGGGAGAGTATGTTGTTGTGGGCAC
C
AACAAGACGGGCATTGTACGGTATATTGGACCAACTGATTTCCAGGAGGGAACATGGATTGGTGTGGAG
CTG
GATCTGCCTGCAGGAAAGAATGATGGCTCCATTGGTGGGAAACAGTATTTCAGGTGCAACCCTGGCT
AT
GGGCTGCTGGTGAGGCCCAGCCGGGTCCGCAGGGCTGTGGGCACTGGGCGCAGGCGCAGTTCAGGGCT
C
CAGCCTCAGGGAGCCCCAGAGGTCCGCAGAAGTGCTACCATCTCGGGCTCTGCCACCAACCTGGCTTCA
CTG
ACAGCTGCACTGGCCAAGGGAGACAGGAGTTACAAGAATCCTGAGAACCGGAAGTCCTGGGCCAGCT
AA


Translation (1843 aa):
MGDSKVKVAVRVRPMNRREIDLHTKCVVDVEANKVILNPVNTNLSKGDARGQPKIFAYDHCFWSMDESVR
E
KYA
GQEDVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYTMMGTADQPGLIPRLCSGLFERTQKEENE
E
QSFKVEVSYMEIYNEKVRDLLDPK
GSRQTLKVREHSVLGPYVDGLSKLAVTSYKDIESLMSEGNKSRTV
A
ATNMNEESSRSHAVFKITLTHTLYDVKSG
TSGEKVGKLSLVDLAGSERATKTGAAGDRLKEGSNINKSL
T
TLGLVISALADQGAGKNKNKFVPYRDSVLTWLLK
DSLGGNSKTAMVATVSPAADNYDETLSTLRYADRA
K
HIVNHAVVNEDPNARIIRDLREEVEKLREQLTKAE
AMKSPELKDRLEESEKLIQEMTVTWEEKLRKTEE
I
AQ
ERQKQLESLGISLQTSGIKVGDDKCFLVNLNADPALNELLVYYLKEHTLIGSANSQDIQLCGMGILP
E
HGIIDITPEGQVVLTPQKNT
RTFVNGSSVSSPIQLHHGDRILWGNNHFFRLNLPKKKKKAEREDEDREA
S
LKNDSSSEQLDADGDSSSEVSSEINFNFEYAQMEVTMKALGSN
DPMQSILSSLEQQHEEEKRSALERQR
L
MYEHELEQLRRRLSPERQNCRGVDRLSFHSPSAQQRLKQWAEE
REATLNNSLMRLREQIVKANLLVREA
S
YIAEELDKRTEYKVTLQIPTSSLDANRK
RGSLLSEPAIQVRRKGKGKQIWSLEKLENRLLDMRDLYQEW
K
ECEEDSP
VSRSYFKRADPFYDEQENHSLIGVANVFLETLFYDVKLQYAVPIINQKGEVAGRLHVEVMRL
S
GAIGERIAGGDDPTEVSSEKEAQENRLVCM
VKILQATGLPQHLCHFVFCKYDFWDQQEPVTVAPEVDTS
S
SPTSKQPQCMVVFDHCS
EFSVNITEDFIEYLSEGALAIEVYGHKMNDPRKNPALWDLGIIQAKTRSLRD
R
WSEVTRKLEFWVQILEQNENGDYCPVEVIAAKDVPTGGIFQLRQGQSRRVQVEVKSVQESGTLPLMEEC
I
LSVGIGCVKVRPLRSPKIHENVH
EEEEDMDSYQDRDLERLRRKWLNALTKRQEYLDQQLQKLVSKHDKT
E
DDADREAQLLEMRLTLTEERNAVMVPSAGSGIPGAPAE
WTPVPGMETHIPVIFLDLNADDFSSQDNLDD
P
EAGWDATLTGEEEEEFFELQIVKQHDGE
VKAEASWDSAVHSCPQLSKGTPADERVFLILRVTVQLSHPA
D
MQLVLRKRICVHVHGRQ
GFAQSLLKKMSHRSSIPGCGVTFEIVSNIPEDAQGVEEREALARMAANVENP
A
SADSEAYIEKYLRSVLAVENLLTLDRLRQ
EVAVKEQLTGKGKLSRRSISSPSMNRLSGSRQELSPSHSL
G
SNK
GRWESQQDVSQTLVSRGIAPGPPALSVSPQNNQSPDPGLGGVAASYLNPVKSLVPQMPKLLKSLFP
V
RDDRRGRHSSPLAHQ
PVPRILVQPTFSDTWATRTEEVSHQVGAAPLAEVMAAPAVKICDKPVKVSSPPS
P
MVVTQPPEGQDGPPSPLSEASSGYFSHSVSSATLSETLTLGLDTTGLGSQTPGSPPALCQVTPEPELAF
L
SCTQSHPPAPEEAHVPAAPTQSTELEVPRAPLLSEPASAVPTSPFRIRKVRTSELKSFTGMLGGASSGA
E
EDPLASEDPSNARGQTLGRLEVTSDSEDASEVPEWLREGEYVVVGTNKTGIVRYIGPTDFQEGTWIGVE
L
DLPA
GKNDGSIGGKQYFRCNPGYGLLVRPSRVRRAVGTGRRRSSGLQPQGAPEVRRSATISGSATNLAS
L
TAALAKGDRSYKNPENRKSWAS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser