NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS36937.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36937.2 Public Mus musculus 14 Ift88 23 108 98 CCDS HistoryNCBI Gene:21821Re-query CCDS DB by CCDS ID:36937.2Re-query CCDS DB by GeneID:21821See the combined annotation on chromosome 14 in Sequence Viewer

Public Note for CCDS 36937.1
The coding region has been updated to extend the N-terminus to one that is more supported by the available transcript and conservation data.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 36937.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000122063.7 ENSMUSP00000113768.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000122063.7Link to Ensembl Protein Viewer:ENSMUSP00000113768.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000122063Re-query CCDS DB by Protein ID:ENSMUSP00000113768
Original member NCBI NM_009376.2 NP_033402.2 Updated not alive Link to Nucleotide Sequence:NM_009376.2Link to Protein Sequence:NP_033402.2Re-query CCDS DB by Nucleotide ID:NM_009376Re-query CCDS DB by Protein ID:NP_033402
Current member NCBI NM_009376.3 NP_033402.2 Accepted alive Link to Nucleotide Sequence:NM_009376.3Link to Protein Sequence:NP_033402.2Re-query CCDS DB by Nucleotide ID:NM_009376Re-query CCDS DB by Protein ID:NP_033402Link to BLAST:NP_033402.2

Chromosomal Locations for CCDS 36937.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 57430544 57430633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57434795 57434857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57437227 57437283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57438242 57438295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57438866 57438929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57439706 57439775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57440931 57441021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57441878 57441982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57444355 57444457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57445565 57445679 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57447541 57447772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57450671 57450741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57455461 57455547 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57472975 57473074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57476043 57476129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57477891 57478077 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57479897 57480005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57480657 57480807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57481396 57481511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57487572 57487624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57488892 57488957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57496173 57496279 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57507205 57507271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57516981 57517091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 57517337 57517458 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2478 nt):
ATGATGGAAAATGTTCATCTGGCACCAGAAACAGATGAGGACGACCTTTACTCTGGTTTCAACGACTACA
AC
CCAGCCTATGATACTGAGGAGTTGGAGAATGACACGGGTTTTCAGCAAGCAGTGAGAACCAGTCATGG
C
AGAAGACCTCCCGTAACTGCTAAAATACCAAGCACAGCAGTCAGCAGACCCATAGCTACTGGATATGGG
TCC
AAGACATCCCTGACATCATCAATGGGAAGACCGATGACAGGGACAATTCAGGATGGAGTTGCTCGAC
CG
ATGACAGCAGTGAGAGCAGCTGGCTTTTCCAAGGCAGCTTTGCGAGGCTCTGCATTTGACCCCCTTGG
T
CAGTCCAGGGGCCCTGCTCCTCCTTTGGAAGCCAAAAATGAAGACAGTCCAGAAGAAAAAATTAGACAG
TTG
GAGAAGAAAGTAAATGAGTTGGTGGAAGAAAGCTGTATTGCCAACAGTTGTGGAGACTTAAAACTGG
CC
TTAGAGAAGGCAAAAGATGCAGGAAGAAAAGAGAGAGTCCTGGTGAGACAACGAGAGCAAGTCACAAG
T
CCAGAAAATATCAACTTGGACTTAACCTACTCCGTTCTTTTCAACTTGGCCAGTCAGTATTCTGCTAAT
GAA
ATGTATGCAGAAGCACTGAACACATACCAAGTTATAGTGAAAAACAAGATGTTTAGCAATGCAGGAA
GA
CTGAAAGTGAATATGGGAAATATTTATTTAAAGCAGAGAAATTATTCCAAAGCCATTAAGTTCTACCG
A
ATGGCCTTAGATCAGATCCCAAGTGTCCATAAAGAAATGAGGATCAAAATAATGCAGAACATTGGAATC
ACA
TTTATAAAAACTGGTCAGTACTCAGATGCCATCAACTCATTTGAGCACATCATGAGCATGGCCCCGA
GC
CTGAAGGCAGGCTTCAACCTCATCCTTAGTTGTTTTGCCATTGGAGATCGGGAGAAAATGAAGAAGGC
A
TTCCAAAAATTAATTGCTGTTCCGTTAGAAATTGATGAAGATGATAAATATATCTCCCCAAGTGATGAT
CCC
CATACTAACTTGCTGATTGAAGCTATAAAAAATGACCACCTTAGGCAAATGGAACGTGAAAGGAAAG
CC
ATGGCAGAAAAATACATCATGACAGCTGCAAAACTCATTGCTCCTGTGATCGAAGCGTCTTTTGCTGT
G
GGTTATAACTGGTGTGTGGAAGTAGTGAAAGCCTCTCAGTATGTGGAGCTGGCCAACGACCTGGAGATT
AAC
AAAGCAATTACTTACTTGAGACAAAAGGACTTTAACCAAGCTGTAGACACATTGAAAATGTTTGAGA
AG
AAGGACAGTAGAGTGAAGAGTGCAGCTGCGACCAACCTCTCGTTCCTGTATTATCTGGAAAACGAATT
T
GCCCAAGCCAGCAGCTATGCAGATTTAGCTGTGAACTCGGATAGATATAACCCGTCAGCTCTCACTAAT
AAA
GGGAACACAGTTTTTGCAAATGGTGATTATGAGAAGGCAGCTGAGTTCTATAAAGAGGCCCTGAGAA
AC
GACTCTTCCTGTACTGAAGCACTGTATAACATTGGCCTCACCTATAAGAAGCTGAACCGTCTGGATGA
A
GCCCTGGACTCCTTCCTGAAACTGCACGCGATCCTTCGGAACAGCGCTCAAGTTCTTTGCCAGATAGCA
AAC
ATATATGAGTTAATGGAAGATCCCAATCAAGCTATTGAATGGCTGATGCAGTTGATCAGCGTTGTTC
CA
ACTGATTCCCAAGCTCTGTCTAAACTGGGAGAGTTATACGATAGTGAGGGAGACAAGTCCCAGGCATT
C
CAATATTACTATGAGTCATACAGGTATTTCCCTTCTAACATTGAAGTCATTGAATGGCTTGGAGCTTAT
TAC
ATTGATACACAGTTCTGCGAGAAAGCCATTCAGTACTTTGAAAGAGCTTCCCTTATACAACCCACAC
AA
GTGAAGTGGCAGCTGATGGTAGCTAGCTGCTTTAGAAGAAGTGGTAACTACCAAAAGGCATTAGATAC
T
TATAAAGAGATTCACAGGAAATTTCCGGAGAATGTTGAATGTTTGCGTTTCTTGGTTCGTCTCTGCACA
GAT
ATTGGATTAAAAGAAGTTCAAGAATATGCCACAAAACTCAAGAGGTTGGAAAAAATGAAAGAAATGA
GG
GAACAGCGCATAAAATCGGGCAGAGACAGCAGCGGGGGTTCTCGCAGCAAACGAGAGGGGAGTGCTGG
C
AGTGACAGTGGCCAGAACAATAGTGCCAGTAGTAAGAGTGAACGACTGAGTGCCAAGCTCAGAGCTTTG
CCT
GGGACAGATGAACCTTATGAAAGTAGCGGTAACAAAGAAATAGATGCCTCCTACGTGGATCCACTGG
GC
CCTCAGATAGAAAGACCAAAAACTGCAGCCAAGAAAAGAATTGACGAGGATGATTTTGCTGATGAAGA
G
TTAGGAGATGACTTGCTCCCAGAATAA


Translation (825 aa):
MMENVHLAPETDEDDLYSGFNDYNPAYDTEELENDTGFQQAVRTSHGRRPPVTAKIPSTAVSRPIATGYG
S
KTSLTSSMGRPMTGTIQ
DGVARPMTAVRAAGFSKAALRGSAFDPLGQSRGPAPPLEAKNEDSPEEKIRQ
L
EKKVNELVEESCIANSCGDLKL
ALEKAKDAGRKERVLVRQREQVTSPENINLDLTYSVLFNLASQYSAN
E
MYAEALNTYQVIVKNKMFSNA
GRLKVNMGNIYLKQRNYSKAIKFYRMALDQIPSVHKEMRIKIMQNIGI
T
FIKTGQYSDAINSFEHIMSMAPSLKAGFNLILSCFAIGDREKMKKAFQKLIAVPLEIDEDDKYISPS
DD
P
HTNLLIEAIKNDHLRQMERE
RKAMAEKYIMTAAKLIAPVIEASFAVGYNWCVEVVKASQYVELANDLEI
N
KAITYLRQKDFNQ
AVDTLKMFEKKDSRVKSAAATNLSFLYYLENEFAQASSYADLAVNSDRYNPSALTN
K
GNTVFANGDYEKAAEFYKEALRNDSSCTEALYNI
GLTYKKLNRLDEALDSFLKLHAILRNSAQVLCQIA
N
IYELMEDPNQAIEWLMQLISVVPTDSQALSKLGELYDSEGDKSQAFQYYYESYRYFPSNIEVIEWLGAY
Y
IDTQFCEKAIQYFERASLI
QPTQVKWQLMVASCFRRSGNYQKALDTYKEIHRKFPENVECLRFLVRLCT
D
IGLKEVQEYATKLKRLEKMKEMREQ
RIKSGRDSSGGSRSKREGSAGSDSGQNNSASSKSERLSAKLRAL
P
GTDEPYESSGNKEI
DASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser