NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36852.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36852.1 Public Mus musculus 14 Nt5dc2 21 106 86 CCDS HistoryNCBI Gene:70021Re-query CCDS DB by CCDS ID:36852.1Re-query CCDS DB by GeneID:70021See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 36852.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000090212 ENSMUSP00000087680 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000090212Link to Ensembl Protein Viewer:ENSMUSP00000087680Re-query CCDS DB by Nucleotide ID:ENSMUST00000090212Re-query CCDS DB by Protein ID:ENSMUSP00000087680
Original member NCBI NM_027289.1 NP_081565.1 Updated not alive Link to Nucleotide Sequence:NM_027289.1Link to Protein Sequence:NP_081565.1Re-query CCDS DB by Nucleotide ID:NM_027289Re-query CCDS DB by Protein ID:NP_081565
Current member NCBI NM_027289.2 NP_081565.1 Accepted alive Link to Nucleotide Sequence:NM_027289.2Link to Protein Sequence:NP_081565.1Re-query CCDS DB by Nucleotide ID:NM_027289Re-query CCDS DB by Protein ID:NP_081565Link to BLAST:NP_081565.1

Chromosomal Locations for CCDS 36852.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 31135347 31135393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31135494 31135587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31135686 31135814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31135918 31135978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31136065 31136167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31136268 31136369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31136596 31136677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31138124 31138210 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31138332 31138472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31138609 31138673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 31138781 31139042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1173 nt):
ATGAAAATTGACGCTTTTCACTATGTACAACTGGGAACGGCCTACAGGGGCCTCAAGCCTGTGCCGGACG
AT
GAAGTGATCGACCTGTACGGCGGCACCCAGCACATCCCACTCTACCAGATGAGCGGCTTCTATGGCAA
G
GGCCCATCTATCAAGCAGTTCATGGACATCTTCTCGCTCCCAGAGATGGCTCTGCTGTCCTGTGTGGTG
GAC
TACTTTCTGGGCCACGGCCTGGAGTTTGACCAAGTACATCTCTACAAGGATGTGACGGATGCTATCC
GC
GATGTGCATGTAAAGGGCCTCATGTACCAGTGGATCGAGCAAGACATGGAGAAGTACATCCTGAGAGG
A
GATGAGACATTTGCGGTGCTGAGCCGCCTGGTGGCCCATGGGAAACAGCTGTTCCTCATTACCAACAGT
CCC
TTCAGCTTTGTGGACAAAGGTATGCGGCACATGGTAGGTCCCGATTGGCGCCAACTCTTCGACGTCG
TC
ATCGTCCAGGCAGACAAGCCCAACTTTTTCACCGACAGGCGCAAGCCTTTTCGCAAGCTTGACGAGAA
G
GGCTCCCTCCACTGGGACCGTATCACTCGCCTAGAGAAGGGCAAGATCTATCGGCAGGGAAACCTGTTT
GAT
TTTCTTCGTCTGACGGAATGGCGAGGGCCGCGTGTGCTCTACTTCGGTGACCACCTTTACAGTGACC
TG
GCGGATCTCATGCTGCGGCACGGCTGGCGCACGGGAGCCATCATCCCTGAGCTGGAGCGCGAGATCCG
C
ATCATCAACACGGAGCAGTACATGCACTCGCTGACCTGGCAGCAGGCTCTCACTGGGCTGCTGGAGCGC
ATG
CAGACCTATCAGGATGCAGAGTCACGGCAGGTGCTGGCTACCTGGATGAAGGAGCGGCAAGAACTGA
G
A
TGCATCACAAAGGCCCTATTCAACGCCCAGTTCGGGAGCATCTTCCGCACCTTCCACAACCCTACCTA
C
TTCTCCCGGCGCCTCGTGCGCTTCTCCGACCTCTACATGGCCTCACTCAGCTGCCTGCTCAACTACCGC
GTA
GACTTCACCTTCTACCCGCGCCGCACACCCCTGCAGCACGAGGCACCCCTCTGGATGGACCAGCTGT
GC
ACTGGCTGCATGAAGACACCCTTTCTTGGTGACATGGCCCACATCCGCTGA


Translation (390 aa):
MKIDAFHYVQLGTAYRGLKPVPDDEVIDLYGGTQHIPLYQMSGFYGKGPSIKQFMDIFSLPEMALLSCVV
D
YFLGHGLEFDQVHLYKDVT
DAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLFLITNS
P
FSF
VDKGMRHMVGPDWRQLFDVVIVQADKPNFFTDRRKPFRKLDEKGSLHWDRITRLEKGKIYRQGNLF
D
FLRLTEWRGPRVLYFGDHLYSDLA
DLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLER
M
Q
TYQDAESRQVLATWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYR
V
DFTFYPRRTPLQHEAPLWMDQLCTGCMKTPFLGDMAHIR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser