NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36723.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36723.1 Public Mus musculus 13 Adamts16 21 106 86 CCDS HistoryNCBI Gene:271127Re-query CCDS DB by CCDS ID:36723.1Re-query CCDS DB by GeneID:271127See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36723.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000080145 ENSMUSP00000079041 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000080145Link to Ensembl Protein Viewer:ENSMUSP00000079041Re-query CCDS DB by Nucleotide ID:ENSMUST00000080145Re-query CCDS DB by Protein ID:ENSMUSP00000079041
Original member Current member EBI,WTSI OTTMUST00000049588 OTTMUSP00000022999 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049588Link to Vega Protein Viewer:OTTMUSP00000022999Re-query CCDS DB by Nucleotide ID:OTTMUST00000049588Re-query CCDS DB by Protein ID:OTTMUSP00000022999
Original member NCBI NM_172053.2 NP_742050.2 Updated not alive Link to Nucleotide Sequence:NM_172053.2Link to Protein Sequence:NP_742050.2Re-query CCDS DB by Nucleotide ID:NM_172053Re-query CCDS DB by Protein ID:NP_742050
Current member NCBI NM_172053.3 NP_742050.2 Accepted alive Link to Nucleotide Sequence:NM_172053.3Link to Protein Sequence:NP_742050.2Re-query CCDS DB by Nucleotide ID:NM_172053Re-query CCDS DB by Protein ID:NP_742050Link to BLAST:NP_742050.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_742050.2 1222 Q69Z28-1 1222 100% 0 0

Chromosomal Locations for CCDS 36723.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 70728852 70728967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70730092 70730239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70735650 70735874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70738490 70738684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70738779 70738980 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70753174 70753300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70763415 70763553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70767798 70768042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70768600 70768723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70770153 70770283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70771983 70772155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70772881 70773029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70777389 70777484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70779520 70779673 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70787027 70787164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70791796 70791901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70793066 70793225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70795450 70795533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70797838 70798037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70800784 70801045 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70836048 70836379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70841269 70841371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 70841490 70841549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3669 nt):
ATGGAGTCCCGAGGTTGTGCTGCGCTCTGGGTGCTGCTGCTGGCGCAGGTCAGTGAGCAGCAGACACCTG
CG
TGCGCCCTGGGACTCGCAGCTGCAGCGTCTGGGAGCCCGGAAGACCCGCAGCCTCCCCCATTCTCTGG
G
TCCAGCTGGCTGGAAACCGGTGAGTATGACCTGGTGTCTGCCTATGAAGTAGACCACAGGGGGGATTAT
GTA
TCCCATGACATCATGCACTACCAGCGGAGGCGTCGGAGAAGAGCTGTGACCCAGCCAGGAGGAGATG
CC
CTGCACCTAAGGCTTAAGGGCCCTAGGCATGACCTCCACCTCGACCTCAAAGCTGCCAGCAACTTGAT
G
GCTCCTGGATTCATGGTGCAAACTCTGGGGAAGGGAGGCACCAAGTCTGTACAGATGTTTCCACCAGAA
GAG
AACTGCTTTTACCAAGGATCCTTAAGGTCCCAGGGGAATTCCTCAGTGGCCCTTTCTACCTGCCAAG
GT
TTGTTAGGCATGATAAGAACAAAAGACACTGATTACTTCTTGAAGCCACTGCCTCCACACCTAACAAG
C
AAACTGAACAGATCTGCACAGGGCGACTCCCCCTCCCATGTTCTGTACAAGAGATCTACAGAGCGCCAG
GCT
CCTAGAGAAAACGAAGTCCTGATGATCACCAGGAAGCGAGATCTGGCAAGACCACACCTGCACCATG
AC
AACTTCCATCTTGGCCCCTCACAAAAGCAGCATTTCTGTGGAAGACGCAAGAAATACATGCCTCAGCC
T
CCCAACGATGACCTCTACATCTTGCCTGATGAGTACAAGCCTAGTTCCCGACACAAGCGCTCGCTCTTG
AAA
TCCCACAGAAATGAAGAGTTAAATGTGGAGACACTGGTGGTGGTTGACAGAAAGATGATGCAAAGCC
AT
GGCCATGAAAACATTACGACTTATGTCCTCACCATTCTCAACATGGTGTCTGCCTTATTCAAGGATGG
A
ACAATTGGGGGAAACATCAACATTGTCATTGTGGGACTCATTCTGCTGGAAGATGAACAGCCAGGGCTG
GCG
ATTAGTCACCATGCAGACCACACGTTAACCAGCTTCTGCCAGTGGCAATCCGGATTGATGGGGAAAG
AT
GGAACTCGTCATGACCACGCCATCTTACTGACTGGTCTGGACATATGTTCCTGGAAGAATGAGCCCTG
T
GACACATTGGGGTTTGCACCCATAAGCGGGATGTGCAGTAAGTACCGCAGCTGCACAGTCAATGAAGAC
TCA
GGACTTGGACTGGCCTTCACCATTGCCCATGAGTCTGGACACAACTTTGGCATGGTCCATGATGGAG
AA
GGGAATATGTGCAAGAAATCTGAGGGCAACATTATGTCCCCAACACTGGCAGGACGCAATGGTGTCTT
C
TCCTGGTCTTCCTGCAGCCGTCAGTACCTGCACAAGTTCTTAAGCACCGCCCAAGCGATATGTCTTGCT
GAT
CAGCCAAAGCCTGTGAAAGAGTATAAGTACCCCGAGAAGCTGCCGGGACAGTTATACGATGCAAATA
CC
CAATGCAAGTGGCAGTTTGGAGAGAAAGCCAAGCTCTGTATGCTGGACTTCAGAAAGGACATCTGTAA
G
GCCTTGTGGTGCCATCGGATTGGAAGGAAATGTGAGACCAAGTTCATGCCAGCAGCAGAGGGTACTCTG
TGT
GGGCAGGACATGTGGTGTCGTGGAGGACAGTGTGTCAAGTACGGTGATGAAGGCCCAAAGCCCACCC
AT
GGCCATTGGTCAGATTGGTCCCCCTGGTCCCCCTGCTCCAGGACCTGTGGGGGAGGAATCTCTCACAG
A
GACCGTCTCTGTACCAATCCCAGACCATCTCATGGAGGGAAGTTTTGCCAGGGCTCCACACGCACTCTG
AAG
CTTTGCAACAGTCAGAGATGCCCTCTGGACAGTGTGGATTTCCGTGCTGCCCAGTGTGCCGAGTATA
AC
AGCAAGCGCTTTCGAGGGTGGCTCTACAAGTGGAAGCCTTACACCCAGTTGGAAGATCAGGACTTATG
C
AAACTCTACTGTATCGCAGAAGGATTTGATTTCTTCTTTTCTTTGTCAAATAAAGTGAAAGATGGGACT
CCA
TGCTCGGAGGATAGCCGTAATGTTTGTATAGATGGGATGTGTGAGAGGGTTGGCTGTGACAATGTCC
TT
GGATCAGATGCAACAGAGGACTCCTGTGGGGTCTGCAAGGGGAATAACTCAGACTGTGTCACGCATAG
A
GGGCTCTACAGTAAGCACCATTCCACCAACCAGTACTACCACATGGTAACCATTCCTTCTGGAGCTCGG
AGC
ATTCACATCTACGAAACAAACATCTCTACCTCCTATATTTCTGTGCGCAATTCTCTCAAGAGATATT
AC
CTGAATGGACACTGGAGTGTGGACTGGCCTGGGCGATACAAGTTTTCGGGTGCCACCTTCAACTACAA
A
CGGTCCTACAAGGAGCCTGAGAATTTAACCTCCCCTGGACCAACCAATGAAACTCTGATTGTGGAGCTT
TTG
TTCCAAGGCAGGAACCCTGGTGTGGCCTGGGAATTTTCATTGCCAAGGTCAGGGGCTAAGAAGACTC
CA
GCTGCCCAGCCCAGCTACTCATGGGCCATCGTACGCTCTGAGTGCTCCGTCTCCTGTGGAGGGGGCAA
G
ATGAACTCAAAGGCGGGATGCTACAGAGACCTGAAGGTTCCGGTGAATGCATCTTTCTGCAACCCCAAG
ACA
CGACCTGTCACAGGCCTTGTGCCCTGTAAGGTGTCACCTTGTCCTTCCAGCTGGTCTGTGGGAAACT
GG
AGCGTGTGCAGCCGGACATGCGGTGGGGGCACCCAGAGCAGGCCCGTGCGGTGCACACGGAGGGCACA
C
TACCGTGACGAGTCCATCCCAGCCAGCCTGTGTCCACAGCCCGAGCCCCCCATTCACCAAGCCTGTAAC
TCT
CAGAGCTGCCCACCTGCTTGGAGCACTGGGCCCTGGGCAGAGTGCTCAAGGACCTGTGGGAAGGGGT
GG
AGGAAGAGGACAGTGGCCTGCAAAAGCACCAACCCCTCAGCTCGAGCCCAGCTGTTGCACGACACTGC
C
TGCACTTCAGAACCCAAGCCTCGGACCCACGAAATCTGCCTGCTCAAGCGCTGCCACAAGCACAAGAAG
CTA
CAGTGGCTGGTATCTGCCTGGTCCCAGTGCTCTGTGACATGCCAGGGGGGGACACAACAGAGAGTTC
TC
AGGTGTGCTGAGAAGTACATCTCCGGAAAGTATCGAGAGCTGGCCTCGAAGAAATGCTTGCATCTGCC
A
AAGCCTGACCTGGAGCTGGAACGCGCCTGCGGCCTGATTCCCTGCCCCAAACACCCTCCGTTTGATGCT
TCA
GGCTCCCCAAGAGGCAGCTGGTTTGCCTCACCCTGGTCTCAGTGCACAGCCAGCTGTGGGGGTGGTG
TG
CAGAGGAGGACTGTACAGTGCCTGCTTCGGGGACAGCCAGCCTCAGATTGCTTCCTGCATGAGAAACC
T
GAGACCTCCTCAGCGTGCAACACCCATTTCTGCCCCATTGCAGAGAAGAGAGGCACCTTCTGCAAAGAC
CTC
TTCCACTGGTGCTACCTGGTACCTCAGCACGGCATGTGTGGCCACAGGTTCTACAGCAAGCAGTGTT
GC
AATACCTGCTCCAAATCCAACCTGTGA


Translation (1222 aa):
MESRGCAALWVLLLAQVSEQQTPACALGLAAAASGSPEDPQPPPFSGSSWLETGEYDLVSAYEVDHRGDY
V
SHDIMHYQRRRRRRAVTQPGGDALHLRLKGPRHDLHLDLKAASNLMAPGFMVQTLGKGGTKSVQMFPPE
E
NCFYQGSLRSQGNSSVALSTCQGL
LGMIRTKDTDYFLKPLPPHLTSKLNRSAQGDSPSHVLYKRSTERQ
A
PRENEVLMITRKRDLARPHLHHDNFHLGPSQKQHFCGRRKK
YMPQPPNDDLYILPDEYKPSSRHKRSLL
K
SHRNEELNVETLVVVDRKMMQSHGHENITTYVLTILNM
VSALFKDGTIGGNINIVIVGLILLEDEQPGL
A
ISHHADHTLTSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDTL
GFAPISGMCSKYRSCTVNED
S
GLGLAFTIAHESGH
NFGMVHDGEGNMCKKSEGNIMSPTLAGRNGVFSWSSCSRQYLHKFLSTAQAICLA
D
QPKPVKEYKYPEKLPGQLYDANTQCKWQFGEKAKLCMLDFRK
DICKALWCHRIGRKCETKFMPAAEGTL
C
GQDM
WCRGGQCVKYGDEGPKPTHGHWSDWSPWSPCSRTCGGGISHRDRLCTNPRPSHGGKFCQGSTRTL
K
LCNSQRCPLDSVDFRAAQCAEYNSKRFRGWLYKWKPYTQLE
DQDLCKLYCIAEGFDFFFSLSNKVKDGT
P
CSEDSRNVCIDGMCE
RVGCDNVLGSDATEDSCGVCKGNNSDCVTHRGLYSKHHSTNQYYHMVTIPSGAR
S
IHIYETNISTSYISVRNSLKRYYLNGHWSVDWPGRYKFSGATFNYKRSYKEPENLTSPGPTNETLIVE
L
L
FQGRNPGVAWEFSLPRSGAKKTPAAQPSYSWAIVRSECSVSCGG
GKMNSKAGCYRDLKVPVNASFCNPK
T
RPVTGLVPCKVSPCPS
SWSVGNWSVCSRTCGGGTQSRPVRCTRRAHYRDESIPASLCPQPEPPIHQACN
S
QSCPPAWSTGPWAE
CSRTCGKGWRKRTVACKSTNPSARAQLLHDTACTSEPKPRTHEICLLKRCHKHKK
L
QWLVSAWSQ
CSVTCQGGTQQRVLRCAEKYISGKYRELASKKCLHLPKPDLELERACGLIPCPKHPPFDA
S
GSPRGSWFASPWSQ
CTASCGGGVQRRTVQCLLRGQPASDCFLHEKPETSSACNTHFCPIAEKRGTFCKD
L
FHWCYLVPQHGMCGHRFYSKQCCNTCSKSNL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser