NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36468.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36468.1 Public Mus musculus 12 Nin 23 108 98 CCDS HistoryNCBI Gene:18080Re-query CCDS DB by CCDS ID:36468.1Re-query CCDS DB by GeneID:18080See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36468.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000085314.10 ENSMUSP00000082422.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000085314.10Link to Ensembl Protein Viewer:ENSMUSP00000082422.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000085314Re-query CCDS DB by Protein ID:ENSMUSP00000082422
Original member Current member EBI,WTSI ENSMUST00000222237.1 ENSMUSP00000152240.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000222237.1Link to Ensembl Protein Viewer:ENSMUSP00000152240.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000222237Re-query CCDS DB by Protein ID:ENSMUSP00000152240
Original member Current member NCBI NM_001081453.1 NP_001074922.1 Accepted alive Link to Nucleotide Sequence:NM_001081453.1Link to Protein Sequence:NP_001074922.1Re-query CCDS DB by Nucleotide ID:NM_001081453Re-query CCDS DB by Protein ID:NP_001074922Link to BLAST:NP_001074922.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074922.1 2113 Q61043-3 2113 100% 0 0

Chromosomal Locations for CCDS 36468.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 70014747 70014956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70017573 70017686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70020834 70021031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70025407 70025481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70026754 70026903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70028012 70028191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70029986 70030132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70030883 70030996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70031657 70031779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70035157 70035270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70038539 70038751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70040587 70040656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70040755 70040880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70042132 70044252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70045147 70045637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70047153 70047274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70049024 70049162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70050665 70050754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70051140 70051250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70054388 70054562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70054831 70054971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70055307 70055443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70055872 70056039 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70056652 70056798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70061151 70061341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70062689 70062728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70078112 70078281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70090536 70090617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 70102651 70102833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6342 nt):
ATGGATGAGGTGGAGGAGGACCAGCATGAAGCCCGACTCAAGGAGCTGTTTGACAGTTTTGACACCCTGG
GA
ACTGGGTCTCTGGGTCAAGAGGAGCTCACTGACCTCTGCCACGTGCTGTGCTTGGAGGATGTGGGCCC
G
GTGCTGCAACAGACGCTACTCCAGGACAACCTCTTGGGCAGGGTACATTTTGACCAATTTAAAGAAGCA
TTA
ATACTTATCTTGTCTAGAACTCTATCCAGTGAGGAGCACTTTGAGGAGTCAGACTGTTCCCCAGAAG
CT
CAGCCCAAATATGTTAGAGGTGGGAAGCGTTATGGACGAAGATCACTGCCCGAGTTTCAAGAGTCTGG
G
GAAGAGATCGAGGAGGTGACAGTGCTTGAGCCACTAGAGGAAGAAGCGAGGTCATCACCCATCCCAGCT
GGG
GACTGCGGCGAGCACTGGAAGACACAACGCAGTGAGGAGTATGAAGCAGAAGGCCAGCTGAGGTTTT
GG
AACCCAGATGACCTGAATGCTTCACATGGTGGGTCTTGCCCTCCTCCAGACTGGATAGAAGAGAAACT
G
CAAGAGGTTTGTGAAGATCTGGGGATCACTCGAGATGGTCACCTGAACCGGAAGAAGCTGGTTTCCATC
TGC
GAACAGTATGGATTACAGAATGTGGATGGAGCGATGCTGGAAGAGGTGTTTCTCAGCCTTGATCCTG
AT
GGAACAATGAGTGTGGAAGACTTTTTCTATGGTCTGTTTAAGACTGGGAAATCCCTCACGCCATCAGC
A
TCTACTCCCTATAGACAACTGAAACGGCATCTCTCTATGCAGTCTTTCGATGAGAGTGGACGGCGGACC
GCA
ACCTCGTCAGCAATGACGAGTACCATTGGCTTCCGGGTCTTCTCCTGCTTGGATGACGGGATGGGCC
AG
GCGTCTGTGGAGAGGATACTGGACACCTGGCAGGAAGAAGGCATTGAGAACAGTCAGGAGATTCTGAA
G
GCCCTGGATTTCAGCCTGGATGGAAACATCAACCTGACAGAGCTGACGCTGGCTCTGGAGAATGAACTT
TTG
GTTACCAAGAATGGCATTCACCAGGCAGCACTAGCTAGCTTCAAGGCCGAGATCCGGCACTTGTTAG
AA
CGAGTTGACCAAGTAGTCAGAGAAAAGGAGAAGCTACGGTCGGACCTGGACAAAGCAGAAAAGCTGAA
G
TCTCTCATGGCTTCCGAGGTGGACGATCACCACGCGGCCATTGAGCGGAGGAATGAATACAACCTCAGG
AAA
CTGGATGAAGAATACAAGGAGCGCATAGCAGCCTTAAAGAACGAACTCCGCCAGGAGAGGGAACAGA
TG
TTGCAGCAAGTGGGCAAGCAGCGGGTGGAGCTGGAACAGGAAATTCAAAAGGCCAAGACGGAAGAGAA
T
TACATCCGGGACCGCCTTGCCCTCTCCCTGAAGGAAAACAATCGCCTGGAGACTGAGCTTCTGGAAAAC
GCA
GAGAAGTTGGCAGAGTACGAGAGCCTGACGCAGAAGCTCCAGCGCAGTTTGGAAAATGTGTTAGCAG
AA
AAGTTTGGTGACCTCGATCCCAGCAGTGCTGAGTTCTTTCTTCAAGAGGAGAGGCTGGCGCAGATGAG
A
AATGAATATGAGCAACAGTGCAGGCTATTACAAGACCAAGTGGATGAGCTTCAGTCTGAACTAGAAGAA
TAC
CAGGCTCAAGGCAGGGTGCTCAGACTCCCCTTGAAGAACTCGCTGTCAGAAGAACTCGACGGTCACA
GT
GGTGGTATTGAGCCCGACCAAGGGCCTGGATCTGAAGAGTGCAACCCCCTGAATATGAGCATTGAGGC
A
GAGCTGGTCATCGAGCAGATGAAGGAGCAGCACCACCGGGACCTGTGTCACCTGAGACTGGAGCTGGAA
GAC
AAAGTGCGCCACTATGAAAAGCAGCTGGATGATACCAGGGTCGCCTCTGAACAGGAGCAGGCAGCCA
TG
AAGCAGAAGTATGAGCAGGGAGTGCACACCTTGGAGAAGCGAGTCAGCGAGCTTCGGAGTGAGATTGC
A
GACCTGGAAGGGCAGGCAGCCGTGCTGAGGGAGGCCCACCACAAGGCCAGCTGCAGGCACGAGGAGGAA
AAG
AGACAACTGCAAATGGCGTTCGATGAGGAAAAGGCTCAGCTCCAGGAGGAGCTGCGGCAGGAGCATG
AG
AGGGAGCTCCAGGCCAGGCTGCAGCAGGCAGCGGAGAGCTTTCGCCAGGAGAGAGAGGGACTCGCCCA
G
GCTGCCTGGACTGAGGAGAAGGTGAGAGGCTTGGAGCAATCTTACCAGGAGCAGCTGCTGAGCCTGGAG
GAG
AAGCATGCTCTAGAGAAAGAAGAGCTGAGGGAAGAGCTCTCGGAACATCACCGAAGGGAACTCCAGG
AG
GGAAGGGAAGAAATGGAAACAGAGTGTAATAGAAGAGTCTCTCAGATAGAAGCCCAGTGCCAGGCTGA
C
TGTGAGAAAGTCACTGAGCACTGTGAACAAACTCTGCAAAGCCTCGAGGTTCGCCACCGCCAGGAGCTG
AGG
GACCTCTTGGACCAGCACCTGGAGGAAAGGTCTCAGTGGGAGTTTGAGAAGGATGAGCTTACACAAG
AG
TGCACAGATGCCCAGGAGCAGCTGAAGGAGGCGCTCCAGAGGGAGAGGGCGACCGCTGCGGCCATGAA
G
CAGGAACAGGAGATACTGGAGAGGACATACAAGGACCGTTTGAATATCCTGAGCACGGAAAGAAAGCAG
CTG
CTGCAAGACCTGAAAGACCTACAGAACGCATCTGAGAGCCAGCATGGCCTCCTGTCTGGCCAGATAC
TT
GAGCTGAAGAGAAGTCAGGAGAGAGAACTGAGGGACCAAGGGCAGGCGCTATGCCAGACGGGGGTCTC
T
GAGCAGCTGGCCAGCCAGCAGCTCGAAAGGCTCCGGGTTGAGCATGAGCAAGAGAGGCGAGAAATGACG
GGC
AAGCTTGCCGCCCTGGAGAGCGCCCACAGAGCAAGCCTTGAGAGAGCAGATCAAGAGAAGGCGGAGA
TG
AGCACAGAAATCTGCAGGCTTCAGAATACAGTCAAGGACATGCAGCAGGCAGCATCTCTCTTGATGCT
T
CAGGGTGGCTGCCAGGCAACGGCAGGGGAGGAGGCAGAAGGAGATGGAGCCATGTCCCTGCTTCAGCAA
GGC
GAGCAGCTATTGGAAGAAAACGGAGATGTCCTCATCAGCCTGCAGAGAGCTCACGAGCATGCAGTGA
AG
GAAAATGCAAAGATGGCTACTGAAATTTCCCGATTGCAGCAGAGGCTGAAGAAGTTAGAGCCGGGGTC
G
GTGATCTCGTCTTGTTTGGAGGAGGGGACGTCTGAGATTTCTGGAAGTTCCAGGGAACAAGTAGAACCC
ATA
ATGAAACAAGGTCCAGCCACCAAGCACTTCCTGAGCGATCTAGGAGACCACGAGGCCCGGGACCTGG
CA
AGTACCGGGACAAGCTCCGTTCAGAGGCAGGAGTGCAAAACCGAGGCGTCGGAAGCTTCCCTGGACTG
C
TTTTCTGAGCTTGAAAACAGTGAAGACACCAGGACCGAGTCCTGGGACCTCAAGAGTCAGATCAGCCAG
CTT
CGGGAGCAACTGACGGTCTTGCGAGCAGACTGCGATCGGGCTTCCGAGAGGAAACAGGACCTGCTTT
TC
GATATCTCTGTGCTGAAAAAGAAACTGAAGATGCTGGAGAGACTCCCGGAGGCATCTTCCAGGTATAA
G
GTATTATACGAGGATGCCGCCCGAGAAAACTCCTGCCTTCAGGAGGAGCTGAGACTTGTAGAGACGCGC
TAC
GAGGAGTCGCTGGACAGCAACAAAGAGCTTACGGCGGAGGTCTACAGGTTGCAGGATGAGATGAAGA
AA
ATGGAGGAGGTGATGGAGACGTTCCTCAGCCTGGAGAAGAGTTACGATGAGGTCAAAGTGGAAAATGA
G
GAACTCCGTGCTCTGGTGTTGAGACTTCAAGGGAAGATGGAGAAGGTGCTGGGAAGGGCCGCCCTGCAG
GGT
GACAGCTACGCCCTCTGGGAAGCCCCTTCAGAAAACCTGGAGGTCGCCTCGGATGAAAAGATGCTTG
AA
CTCCGTCAGACTCCGAAAGAGTGTACGCCCAAGGTCGTGAGCATGCACCACATCATAGAAGAGTGTAC
A
CAAGAAACCCAGTGCTGTGAGCAGGGAAGCACGAAGCTCCTAGCTAGAATAAAAGCACACGAAATCGCC
TGG
TTCCACAGAGCAATTAAGACACATCCGGAAAAGCCTAGCGCGCAGAACCGAGTCATCCCGGAGGGAA
GT
GCTGCTCTCCTAGGCCTACAAGACAAGCATCTTCAGCAGGAGGCCACCATCGCAGAGTTAGAACTAGA
G
AAGCAAAAGCTACAGGAGCTGACTAGAAATCTGAGGGAGCGAGTCACTGCACTAGTTAGGCAAAAAGAC
GCC
CCTTCTCAAGGGCAGAAGGAGGAGGAGCTGAAGGCAATGATGCAGGACCTGCAGATCACGTGCGGGG
AG
ATGCAGAGGAAGGTTGAACTCCTGAGATATGAATCTGAAAAGCTTCAAGAGGAAAATTCTATTTTGAG
A
AATGAAATTACTACTTTAAATGAAGAAGATAGCATCTCTAACCTGAAATTGGAGGAATTAAATGGCTCT
CAG
GAAGAATTGTGGCAGAAAATAGAAACCATAGAGCAGGAAAAAGCTTCAATTCAGACAATGGTTGAAA
AA
TTAAAGAAACAGGTTTCAGATTTAAAAATCAAAAACCAACAGTTGGATTCAGAAAATATAGAACTCAG
C
CAAAAGAACTCCCAAAACAAGGAAGAACTGAAAACCCTTAATCAACGTCTGGCAGAAATGCTGTGCCAG
AGG
GAGGAGCCAGGAGCTTGCACCTCTGAGAAATGGGAACAAGAAAATGCAAGCCTCAAAGAAGAACTGG
AT
CACTACAAAGTGCAGACTTCCACTTTGGTGTCTTCTCTGGAGGCAGAACTTTCCGAAGTTAAACTGCA
G
ACTCACGTCATGGAGCAGGAAAACCTCCTTCTCAAAGATGAACTGGAGAGACTGAAGCAACTGCACAGA
TGT
CCTGACCTCTCTGACTTCCAGCAAAAAATGTCTAGCATTCTAAGCTACAATGAAAAACTGCTGAAGG
AA
AAAGAAGTTCTGAGTGAAGAGTTAAAGAGCTGTGCAGATAAGCTGGCAGAGTCAAGCCTCTTAGAGCA
C
AGAATTGCTACAATGAAGCAGGAGCAGACCGCCTGGGAAGAGCAGAGTGAGAGCCTGAAGTCACAGCTG
GCA
GTGTCGCAGGCAAAGGTTCAGAACTTAGAAGATGTCCTGCAGAATGTCAACCTTCAGATGGCTGAGA
TT
GAATCAGATCTCCAAGTGACTCGACAGGAAAAGGAGGCGCTAAAGCAGGAAGTGATGTCATTACACAG
A
CAGCTTCAGAATGCCATTGATAAGGACTGGGTCTCGGAAACAGCTCCCCATCTCTCAGGGCTCCGGGGC
CAG
CAGAGAAGGCTGTCCTGGGACAAACTGGACCATCTGATGAATGAGGAACCACAGCTGCTTTGTCAAG
AA
AGCAAGAGACTCCAGACTGTGGTACAGAATACCCAAGCAGATCTCACCCACTCCCGGGAGAAGGTCCG
T
CAACTGGAATCCAACCTCCTTCCCACCAAACACCAAAAACAACTCAACCAACCATGTACTGTGAAGTCC
ACA
GAACAAGAAAAACTGACCTTAAAGAGAGAGTGTGAACAGTCTCAGAAAGAACAATCTCCTACCAGCA
GG
AAGGTGGGTCAGATGGGTTCCCTTGAGCGAGGATTAGAAACAATCCATTTGGAAAACGAAGGTCTGAA
G
AAGAAACAGATGCAGCCCCTGAGGTCCACTGTGACGCGTAGCCCATCCTCTCACTGGGATCTGCAGTTG
CTC
CAGCAGCAAGCCTGTCCGATGGTGCCCAGGGAGCAGTTTCTGCAGCTTCAACAGCAGCTGCTGCAGG
CA
GAAAAGAGAAGCCAGCACCTGCAGGAGGAGCTCGAAAACAGAACCTCCGAAACCAACACACCACAGGG
A
AACCAGGAACACCTTGTAAATCTCATGGAAGAACGAATGATAGAAGTTGAACAAAAACTAAAGCTGGTG
AAG
AGACTTCTTCAAGAAAAAGTAAACCAGCTCAAAGAACAACTCTGCAAGAACACAAAAACAGATGCCG
TG
GTGAAGGATTTGTATGTCGAAAATGCCCAGTTGTTGAAAGCTCTGGAGATGACTGAACAGCGCCAGAA
G
ACAGCAGAAAAGAGAAATTTCCTCCTAGAAGAGAAGATTGCCAGCCTCAGTACCATCGTCAGGAACCTG
GCA
CCAGCACCACTGACTTCTATGCCTCCTCTGAGGTCATAG


Translation (2113 aa):
MDEVEEDQHEARLKELFDSFDTLGTGSLGQEELTDLCHVLCLEDVGPVLQQTLLQDNLLGRVHFDQFKEA
L
ILILSRTLSSEEHFEES
DCSPEAQPKYVRGGKRYGRRSLPEFQESGEEIEEVTVLEPLEEEARSSPIPA
G
DCGE
HWKTQRSEEYEAEGQLRFWNPDDLNASHGGSCPPPDWIEEKLQEVCEDLGITRDGHLNRKKLVSI
C
EQYGLQNVDGA
MLEEVFLSLDPDGTMSVEDFFYGLFKTGKSLTPSASTPYRQLKRHLSMQSFDESGRRT
A
TSSAMTSTIGFRVFSCLDDGMGQASVERILDTWQEEGIENSQEILK
ALDFSLDGNINLTELTLALENEL
L
VTKNGIHQAALASFKAEIRHL
LERVDQVVREKEKLRSDLDKAEKLKSLMASEVDDHHAAIERRNEYNLR
K
LDEEYKERIAALKNELRQEREQMLQQVGKQRVELEQEIQKAKTEENYIRDRLALSLK
ENNRLETELLEN
A
EKLAEYESLTQKLQRSLENVLAEK
FGDLDPSSAEFFLQEERLAQMRNEYEQQCRLLQDQVDELQSELEE
Y
QAQGRVLRLPLKNSLSEELDGHSGGIEPDQ
GPGSEECNPLNMSIEAELVIEQMKEQHHRDLCHLRLELE
D
K
VRHYEKQLDDTRVASEQEQAAMKQKYEQGVHTLEKRVSELRSEIADLEGQAAVLREAHHKASCRHEEE
K
RQLQMAFDEEKAQLQEELRQEHERELQARLQQAAESFRQEREGLAQAAWTEEKVRGLEQSYQEQLLSLE
E
KHALEKEELREELSEHHRRELQEG
REEMETECNRRVSQIEAQCQADCEKVTEHCEQTLQSLEVRHRQEL
R
DLLDQHLEERSQWEFEKDELTQECTDAQEQLKEALQRERATAAAMKQEQEILERTYKDRLNILSTERKQ
L
LQDLKDLQNASESQHGLLSGQILELKRSQERELRDQGQALCQTGVSEQLASQQLERLRVEHEQERREMT
G
KLAALESAHRASLERADQEKAEMSTEICRLQNTVKDMQQAASLLMLQGGCQATAGEEAEGDGAMSLLQQ
G
EQLLEENGDVLISLQRAHEHAVKENAKMATEISRLQQRLKKLEPGSVISSCLEEGTSEISGSSREQVEP
I
MKQGPATKHFLSDLGDHEARDLASTGTSSVQRQECKTEASEASLDCFSELENSEDTRTESWDLKSQISQ
L
REQLTVLRADCDRASERKQDLLFDISVLKKKLKMLERLPEASSRYKVLYEDAARENSCLQEELRLVETR
Y
EESLDSNKELTAEVYRLQDEMKKMEEVMETFLSLEKSYDEVKVENEELRALVLRLQGKMEKVLGRAALQ
G
DSYALWEAPSENLEVASDEKMLELRQTPKECTPKVVSMHHIIEECTQETQCCEQGSTKLLARIKAHEIA
W
FHRAIKTHPEKPSAQNRVIPEGSAALLGLQDKHLQQEATIAELELEKQKLQELTRNLRERVTALVRQKD
A
PSQGQKEEELKAMMQDLQITCGEMQRKVELL
RYESEKLQEENSILRNEITTLNEEDSISNLKLEELNGS
Q
EEL
WQKIETIEQEKASIQTMVEKLKKQVSDLKIKNQQLDSENIELSQKNSQNKEELKTLNQRLAEMLCQ
R
EEPGACTSEKWEQENASLKEELDHYKVQ
TSTLVSSLEAELSEVKLQTHVMEQENLLLKDELERLKQLHR
C
PDLSDFQQKMSSILSYNEKLLKEKEVLSEELKSCADK
LAESSLLEHRIATMKQEQTAWEEQSESLKSQL
A
VSQAK
VQNLEDVLQNVNLQMAEIESDLQVTRQEKEALKQEVMSLHRQLQNAIDKDWVSETAPHLSGLRG
Q
QRRLSWDKLDHLMNEEPQLLCQESKRLQTVVQNTQADLTHSREK
VRQLESNLLPTKHQKQLNQPCTVKS
T
EQEKLTLKRECEQSQKEQSPTSRK
VGQMGSLERGLETIHLENEGLKKKQMQPLRSTVTRSPSSHWDLQL
L
QQQACPMVPREQFLQLQQQLLQAEKRSQHLQEELENRTSETNTPQ
GNQEHLVNLMEERMIEVEQKLKLV
K
RLLQEKVNQLKEQ
LCKNTKTDAVVKDLYVENAQLLKALEMTEQRQKTAEKRNFLLEEKIASLSTIVRNL
A
PAPLTSMPPLRS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser