NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, October 16, 2019, starting at 8:00 a.m. EDT for approximately 30 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36444.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36444.1 Public Mus musculus 12 Akap6 21 106 86 CCDS HistoryNCBI Gene:238161Re-query CCDS DB by CCDS ID:36444.1Re-query CCDS DB by GeneID:238161See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 36444.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000095737 ENSMUSP00000093406 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000095737Link to Ensembl Protein Viewer:ENSMUSP00000093406Re-query CCDS DB by Nucleotide ID:ENSMUST00000095737Re-query CCDS DB by Protein ID:ENSMUSP00000093406
Original member Current member NCBI NM_198111.2 NP_932779.2 Accepted alive Link to Nucleotide Sequence:NM_198111.2Link to Protein Sequence:NP_932779.2Re-query CCDS DB by Nucleotide ID:NM_198111Re-query CCDS DB by Protein ID:NP_932779Link to BLAST:NP_932779.2

Chromosomal Locations for CCDS 36444.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 52795871 52796200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52880639 52880890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52886309 52888063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52911801 52911923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52937135 52937231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52938343 52938506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53010474 53010622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53025721 53025841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53069107 53069253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53072290 53072511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53104515 53104730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 53139381 53142728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6924 nt):
ATGTTAACCATGAGTGTGACCCTTTCCCCACTGCGGTCCCAGGACCCAGACCCCATGGCGACTGATGCCT
CG
CCCATGGCCATCAACATGACACCTACCGTGGAGCAGGAGGAAGGAGAGGGAGAAGAGGCCGTGAAGGA
C
GTGGGTGCTGAGCAGCAGTATGGAAAGCCACCTCCACTCCACACAGCAGCCGACTGGAAGATTGTCCTG
CAC
TTACCTGAGATTGAGACCTGGCTCCGGATGACCTCAGAGAGGGTCCGTGACCTAACCTACTCGGTCC
AG
CAGGATGCAGACAGCAAGCATGTGGATGTGCATCTAGTTCAGCTAAAGGATATTTGCGAGGATATTTC
C
GACCACGTGGAGCAGATCCATGCCCTCCTTGAGACGGAGTTCTCCCTGAAGCTGCTGTCCTACTCGGTC
AAT
GTCATCGTAGACATCCACGCAGTGCAGCTGCTCTGGCACCAGCTCCGCGTATCCGTGCTGGTCCTCC
GG
GAGCGCATCCTACAAGGTCTGCAGGACGCCAATGGCAACTACACCAGGCAGACTGACATTCTGCAAGC
A
TTCTCTGAAGAAACAACAGAGGGCCGGCTTGACTCCCTCACAGAAGTGGACGACTCTGGGCAGTTAACT
ATC
AAATGCTCTCAGAATTATTTGTCTCTGGATTGTGGTATTACTGCCTTTGAACTTTCTGACTACAGTC
CA
AGTGAGGATCTGCTTGGTGGCCTGGGCGACATGACCACTAGCCAGGCCAAAACTAAATCGTTTGACTC
T
TGGAGTTACAGCGAGATGGAAAAGGAATTTCCCGAGCTCATCCGAAGCGTTGGGCTGCTTACAGTGGCC
ACT
GAGCCTGTCCCTTCCAGCTGTGGAGCAGCCAATGAGGACTCATCTCAAGTGATCCTTTCAGAGGACC
AC
AGAGGTGGACATGAGGAAGATGGCGCTCTTGAACCTGGAGAGCAGCTGGGCTCAACACTGGAGACGTC
T
TCCTTAGGGGACACACTGACAAACGCTGCTGAACACCCTCCGGAGACAGCAAACCAAGACTCTACTTCC
TCT
CCGCAGCTTGGTGCGAAAAAATCCCAGCCTGGTCCTTGTGAAATGATGACTCCCAAGAGATCCATCC
GC
GATTGCTTTAATTATAACGAGGACTCTCCCACGCAGCCCACATTGCCCAAAAGAGGGCTATTTCTAAA
A
GAAACTCTTAAGAACGAGCGGAGAGGCAGTGATGGGAAGGGGAGGGTGGTTGACCTGAAGCCTGAGCTG
AGC
AGAAGCACCCCGTCCCTGGTGGAACCCCCTGACAGATCGAAGCTCTGCCTAGTGTTGCAGTCTTCCT
AC
CCCAGCAGCCCTTCTGCCGCCAGCCAGTCCTATGAGTGTTTGCACAAGGTGGGGATCGGCAATCTTGA
A
AACATAGTCAGAAGTCACATTAAAGAAATTTCTTCCAGTTTGGGAAGGCTTACTGACTGCCATAAAGAG
AAA
CCGCGACTGAAAAAGCCTCACAAGACCTTGGCCGAGGTGTCCCTGTGCAAAATACCTAAACGGGGAA
CT
GGTTCAGGAAAGCAATCCGAGAATACCAGGAGCTCAGTCGTGCCGACCATGGTGTCTCCTGGAGCTCC
G
AAAGCCACGGCGAGACCAGCAACAGATTCTGCGTCTACAACCTCAGGTGACACGTGCCATCAGAGAAAT
CGG
GGTGGAAAATTGCCAGCGCAGTCGAAGGCCTCCAGCTCATCCCCTTGTAGTCACAGCAGTGAGTCCT
CT
CTTGGCTCAGACAACATCAAATCCCCACTTCCTCTCCTTTCAAAAAGCCAAAAAGGCTCCCCACCCGC
T
CCATGTCACGCCACACAGAACGGTCAGGTGGTGGAGGCCTGGTACGGCTCTGATGAATACCTAGCGCTG
CCA
TCTCACCTCAAACAAACGGAGGTGTTAGCTCTGAAACTGGAGAACCTAACCAAGCTTCTACCCCAGA
AA
CCCAGAGGAGAGACTATCCAGGATATTGATGACTGGGAACTGTCTGAGATGAATTCAGACTCTGAAAT
C
TATCCAACGTACCATATCAAGAAAAAACACACAAGGCTAGGCACCGTCTCTCCGAGCTCATCCAGCGAC
ATA
GCCTCATCTCTCGGGGAGAGCATTGAATCTGGGCCCCTGAGTGACATTCTTTCTGATGAGGACTTAT
GT
ATGCCCCTCTCCGGCATGAAAAAGTTCACTGATGAGAAATCAGAGAGACCTTCATCCTCTGAGAAGAA
T
GAGAGCCATTCTGCTACAAAATCAGCCTTAATTCAGAAACTAATGAAAGATATTCAGCACCAAGATAAC
TAT
GAAGCCATCTGGGAAAGAATTGAGGGGTTTGTGAACAAGCTGGACGAATTCATTCAGTGGCTAAACG
AA
GCCATGGAGACCACGGAGAACTGGACTCCGCCTAAAGCCGAGACCGACAGCCTCCGGCTGTACCTGGA
G
ACACACTTGAGCTTTAAGTTGAACGTAGACAGTCACTGTGCCCTCAAGGAAGCCGTGGAGGAAGAAGGA
CAC
CAACTTCTTGAGCTCATTGCGTCTCACAAAGCAGGACTGAAGGACATGCTGAAGATGATTGCAAGTC
AA
TGGAAGGAGCTGCAGAGGCAAATCAAACGGCAACACAGCTGGATTCTCAGAGCCCTGGACACCATCAA
A
GCCGAGATACTGGCTACTGATGTGTCTGTGGAGGACGAGGAGGGGACGGGGAGCCCCAAGGCTGAGGCT
CAG
CTCTGCTACCTGGAAGCTCAGAGAGACGCTGTGGAGCAGATGTCCCTCAAGCTGTACAGCGAGCAGT
AT
ACCAGTGGTAGCAAGAGGAAAGAAGAGTTTGCCGACATGTCGAAAGCGCATTCGGTGGGAAGCAATGG
G
CTTCTGGACTTTGATTCAGAATATCAGGAGCTCTGGGATTGGCTGATTGACATGGAGTCCCTTGTGATG
GAC
AGCCACGACCTGATGATGTCAGAGGAGCAGCAGCAGCATCTTTACAAGCGCTACAGCGTGGAAATGT
CC
ATCAGGCACCTGAAAAAGACAGAGCTACTTAGCAAGGTTGAAGCTTTGAAGAAAGGTGGCCTTTCACT
A
CCAAATGATATCCTGGAAAAAGTGGATTCAATTAATGAAAAATGGGAGCTGCTTGGGAAAACCCTAAGA
GAG
AAGATACAGGACACAATGGCAGGCCACAGTGGGTCGGGCCCACGTGACCTGCTCTCTCCTGAAAGCG
GA
AGCCTGGTAAGGCAGCTGGAGGTCAGGATCAAAGAGCTGAAAAGGTGGCTAAGAGATACAGAGCTTTT
C
ATCTTCAATTCCTGTCTGAGACAAGAGAAGGAAGGAACGAGCGCCGAGAAACAACTCCAATACTTTAAG
TCG
CTCTGTCATGAGATCAAGCAGCGGCGTAGAGGAGTGGCCTCCATTCTGAGGTTGTGCCAGCACCTTC
TG
GATGACCGGGACACTTGTAATCTGAACGCAGATCACCAGCCCATGCAGCTGATCATTGTAAACCTTGA
A
AGAAGGTGGGAAGCCATCGTCATGCAAGCTGTCCAGTGGCAAACACGGTTACGAAAGAAGATGGGAAAA
GAA
TCTGAGACTCTGAATGTGATTGACCCTGGCTTGATGGACCTGAATGGAATGAGTGAGGATGCCCTGG
AA
TGGGATGAGACAGACATAAGTAACAAACTCATTAGTGTGCATGAAGAATCCAACGACCTTGATCAAGA
C
CTGGAGCCTATGGTCCCAACAGTGAAACTTGAAGAGACACACCACAAGGACTCCGGTTATGAAGAGGAG
GCA
GGTGACTGTGGAGGGTCCCAGTATACCTCAAATATCACTGCCCCTTCCAGCCCACACATTTACCAAG
TG
TACAGTCTCCACAATGTTGAGTTCCACGAGGACAGCCACACTCAGTTTCTAAAAAGCAGCCCCAAGTT
C
ACAGGCACAGTGCAGCCCACTGTTTTAACTAAGAGCCTCAGTAAAGATTCTTCATTTTCATCCACAAAA
TCG
TTACCAGACCTTTTAGGGGGTTCCAGCTTGGTGAGGCCTTACTCGTGTCAGAGTGGAGACTTGAGCC
AG
AATTCAGGCAGTGAGAGTGGAATTGTCAGCGAAGGAGACAATGAGATGCCAACCAACTCCGACATGAG
C
TTGTTCAGTATGGTCGATGGGTCCCCGAGTAACCCTGAAACACAACATCTGGACCCACAAATGGGAGAC
GCA
GCCAATGTGCTGGAGCAAAAATTTAAAGATGAGGGGGAGTGCATTAAGCTTTCAAGTGTCTCTCAGG
CA
TCTGTCTCACCAGTGGGTTGTGTAAATGGGAAAGCTGGGGACTTAAACAGTATTACCAAACACACCAC
T
GATTGTTTGGGAGACGAATTACAAGGAAAACATGAGGTGTTTACATTTTATGACTACTCGTACCTCCAA
GGC
TCAAAACTCAAATTCCCAATGATAATGAAACAGCCGCAGAGTGAGAAGGCACATTTGGAGGATCCCC
TT
CTTCGTGGTTTCTATTTTGATAAAAAGTCCTGCAAACCTAAACATCAGACTTCTGAGTCACAACCAGA
C
GCGCCCCTCCATGAAAAGATCTTGGCAAGTGCCCCCCACGAGATGGGTCGAAGCTCATACAAAAGTAGC
GAC
ATAGAGAAGGCACTCACGGGCATCCAGAATGCCCGACAGCTCTCCCTTTTATCTCGTAGCTCATCTG
TA
GAGTCCCTTTCCCCAGGGGGTGATTTGTTTGGATTGGGAATCTTTAAAAATGGCAGTGACAGCCTCCA
G
CGAAGCACTTCTTTAGAAAGTTGGTTGACATCCTATAAGAGCAACGAGGATCTTTTTAGCTGTCACAGC
TCT
GGGGACATAAGTGTGAGCAGTGGCTCGGTTGGTGAGCTGAGCAAGAGGACATTAGATCTTTTGAATC
GT
CTGGAGAACATACAGAGCCCCTCAGAGCAAAAGATCAAGCGGAGTGTTTCAGATATCACTCTGCAAAG
C
AGTTCCCAAAAGATGTCCTTCAGTGGCCAGATGTCACTGGATGTCGCATCCTCTATCAATGAAGACTCG
CCG
GCATCTCTTACCGAACTGAGTAGCAGCGATGAGCTCTCTCTTTGCTCGGAGGACATTGTGTTACACA
AA
AACAAGGTCCCAGAGTCCAACGCATCATTCAGGAAGCGCCTGAATCGCTCGGTGGCTGATGAGAGCGA
C
GTCAATGTCAGCATGATTGTCAACGTCTCCTGCACCTCTGCTTGCACTGATGACGAAGACGACAGCGAC
CTC
CTCTCCAGCTCCACTCTCACCTTGACGGAAGAAGAGCTGTGTCTCAAAGATGAGGATGACGACTCCA
GT
ATCGCAACGGATGATGAAATTTATGAGGAAAGCAACCTGATGTCTGGGCTGGACTACATCAAGAACGA
A
CTGCAGACGTGGATAAGACCCAAACTTTCCTTGTCGAGAGAAAAGAAACGGCCCAGTGTCACTGATGAA
ATA
AAGGTCAATAAAGATGGAGGAAGTACCGAGAGGGCCAATCCCTCGGACACCCTGGACATTGAGGCCC
TT
CTAAATTGCTCCATAAAACGTCTCTCTGAAAACAATGGGAATGGCAAGAACCCACCCAGAACTCATGA
C
TTAGGAACCAAAGGTGAAAATAAGAAAAATACGTACGACGTTACTAAAGATCCACATGTGGCCGACATG
GAA
AATGGCAATGTTGAAAGTACTCCAGAGAGAGAAAAGGAGAAGCCAGAGATCCCAGAGGCATCAGCGA
AC
CTTGCTTCAAATGTGAAAAAGATTTCTGAATCCAAGCACGACGAGTATGAAGCATTAATGGATGGTTC
T
GATGATTCAAGTGTCACTGGGAAGGAATTTGGTCCCCCAAATGATAGGCATCCTCCACAGATTGGTGCC
GAT
CCCCAGCATCCTGAAAGGGGTGACTGCACATCAGTCCAGAACTCTTGCTCAGGACTACTGTTGGAAA
CC
GGTGGCGGAAGCAGACAAGATAGTGATGGACTCAAATCTTTGTCTAATGATGCACCAAGTGTGGCTAG
A
AACGCTGCTGGTTGCTGCCTACTCGAACAAAATGAGACAGAGGAAAGTGCTTCTATCAGCAGCAGCACT
TCC
TGTTGCAACTGCAAGCCAGATGTTTTCCATCAGAAAGATGATGAAGATTGTTCGGTACATGACTTTG
TT
AAGGAAATCATTGACATGGCATCAACAGCCCTCAAAAGTAAATCACAACCTGAGAGTGAGGTGGCCGC
T
CCCACGTCACTGACCCAAATTAAGGAGAAAGTGTTAGAGCATTCGCATCGGCCCATACACCTGAGGAAG
GGA
GATTTTTACTCCTACCTATCTCTTTCGTCCCATGACAGTGACTGTGGGGAGGTCACCAATTACATAG
AT
GAGAAGAGCAACACCCCATTGCCACCAGACACCGTGGACTCTGGCTTAGATGACAAGGAAGACGTGGA
C
TGCTTCTTTGAAGCTTGTGTTGAGGACGAGCCTGCTGATGAGGAAGCCCGTCTCTCCAGTGCCCTTCCA
AAT
GAATCAGAAGTCCAGGATGAAGCTGCTAAGCCAGAACAAATGACAGCCAGCTCTTCTGTGTTCCGTG
AT
GAGACAGACACGGTGCCTCTTTCAGGACTTTCCCCTCAGAAGGGAGCTGATGATGCAAAGGAAGGAGA
T
GGTGCGTCCCACACTTCCCAGGGCTGTGTGGAGAGCGCAGAGCCTACCACCCCCCCAGGAAAGGCCAAG
AGA
GAGGGGAGTTCAAGAAAGCAAAGTGTATCAGGAACGCCAGAAGAAAACGCTGCTTCAGCCAAACCGA
AA
ATTCAAGCTTTCTCTTTGAATGCAAAACAGCCAAAAGGCAAGGCTGCACTGTATCCCAGCCCCCAAAC
T
TTAACCTGCAAAGAGAAGCTCGTAAGCTTTCATGAAGATCGACATAGTAACATGCATAGGTAG


Translation (2307 aa):
MLTMSVTLSPLRSQDPDPMATDASPMAINMTPTVEQEEGEGEEAVKDVGAEQQYGKPPPLHTAADWKIVL
H
LPEIETWLRMTSERVRDLTYSVQQDADSKHVDVHLVQLK
DICEDISDHVEQIHALLETEFSLKLLSYSV
N
VIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQTDILQAFSEETTE
GRLDSLTEVDDSGQLT
I
KCSQNYLSLDCGITAFELSDYSPSEDLLGGLGDMTTSQAKTKSFDSWSYSEMEKEFPELIRSVGLLTVA
T
EPVPSSCGAANEDSSQVILSEDHRGGHEEDGALEPGEQLGSTLETSSLGDTLTNAAEHPPETANQDSTS
S
PQLGAKKSQPGPCEMMTPKRSIRDCFNYNEDSPTQPTLPKRGLFLKETLKNERRGSDGKGRVVDLKPEL
S
RSTPSLVEPPDRSKLCLVLQSSYPSSPSAASQSYECLHKVGIGNLENIVRSHIKEISSSLGRLTDCHKE
K
PRLKKPHKTLAEVSLCKIPKRGTGSGKQSENTRSSVVPTMVSPGAPKATARPATDSASTTSGDTCHQRN
R
GGKLPAQSKASSSSPCSHSSESSLGSDNIKSPLPLLSKSQKGSPPAPCHATQNGQVVEAWYGSDEYLAL
P
SHLKQTEVLALKLENLTKLLPQKPRGETIQDIDDWELSEMNSDSEIYPTYHIKKKHTRLGTVSPSSSSD
I
ASSLGESIESGPLSDILSDEDLCMPLSGMKKFTDEKSERPSSSEKNESHSATKSALIQKLMKDIQHQDN
Y
EAIWERIE
GFVNKLDEFIQWLNEAMETTENWTPPKAETDSLRLYLETHLSFKLNVDSHCALKEAVEEEG
H
QLLELIASHKA
GLKDMLKMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVEDEEGTGSPKAEA
Q
LCYLEAQRDAVEQMSLKLYSEQYTSGSKRKEEFADMSKAHSVGSN
GLLDFDSEYQELWDWLIDMESLVM
D
SHDLMMSEEQQQHLYK
RYSVEMSIRHLKKTELLSKVEALKKGGLSLPNDILEKVDSINEKWELLGKTLR
E
KIQDTMAGHSGSGPRDLLSPESGSLVRQLEVRIKELKRWLRDTELFIFNSCLRQEKEGTSAEKQLQYFK

S
LCHEIKQRRRGVASILRLCQHLLDDRDTCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLRKKMGK
E
S
ETLNVIDPGLMDLNGMSEDALEWDETDISNKLISVHEESNDLDQDLEPMVPTVKLEETHHKDSGYEEE
A
GDCGGSQYTSNITAPSSPHIYQVYSLHNVEFHEDSHTQFLKSSPKFTGTVQPTVLTKSLSKDSSFSSTK
S
LPDLLGGSSLVRPYSCQSGDLSQNSGSESGIVSEGDNEMPTNSDMSLFSMVDGSPSNPETQHLDPQMGD
A
ANVLEQKFKDEGECIKLSSVSQASVSPVGCVNGKAGDLNSITKHTTDCLGDELQGKHEVFTFYDYSYLQ
G
SKLKFPMIMKQPQSEKAHLEDPLLRGFYFDKKSCKPKHQTSESQPDAPLHEKILASAPHEMGRSSYKSS
D
IEKALTGIQNARQLSLLSRSSSVESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHS
S
GDISVSSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQKMSFSGQMSLDVASSINEDS
P
ASLTELSSSDELSLCSEDIVLHKNKVPESNASFRKRLNRSVADESDVNVSMIVNVSCTSACTDDEDDSD
L
LSSSTLTLTEEELCLKDEDDDSSIATDDEIYEESNLMSGLDYIKNELQTWIRPKLSLSREKKRPSVTDE
I
KVNKDGGSTERANPSDTLDIEALLNCSIKRLSENNGNGKNPPRTHDLGTKGENKKNTYDVTKDPHVADM
E
NGNVESTPEREKEKPEIPEASANLASNVKKISESKHDEYEALMDGSDDSSVTGKEFGPPNDRHPPQIGA
D
PQHPERGDCTSVQNSCSGLLLETGGGSRQDSDGLKSLSNDAPSVARNAAGCCLLEQNETEESASISSST
S
CCNCKPDVFHQKDDEDCSVHDFVKEIIDMASTALKSKSQPESEVAAPTSLTQIKEKVLEHSHRPIHLRK
G
DFYSYLSLSSHDSDCGEVTNYIDEKSNTPLPPDTVDSGLDDKEDVDCFFEACVEDEPADEEARLSSALP
N
ESEVQDEAAKPEQMTASSSVFRDETDTVPLSGLSPQKGADDAKEGDGASHTSQGCVESAEPTTPPGKAK
R
EGSSRKQSVSGTPEENAASAKPKIQAFSLNAKQPKGKAALYPSPQTLTCKEKLVSFHEDRHSNMHR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser