NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36267.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36267.1 Public Mus musculus 11 Med13 23 108 98 CCDS HistoryNCBI Gene:327987Re-query CCDS DB by CCDS ID:36267.1Re-query CCDS DB by GeneID:327987See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36267.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000043624.8 ENSMUSP00000044268.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000043624.8Link to Ensembl Protein Viewer:ENSMUSP00000044268.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000043624Re-query CCDS DB by Protein ID:ENSMUSP00000044268
Original member Current member NCBI NM_001080931.2 NP_001074400.1 Accepted alive Link to Nucleotide Sequence:NM_001080931.2Link to Protein Sequence:NP_001074400.1Re-query CCDS DB by Nucleotide ID:NM_001080931Re-query CCDS DB by Protein ID:NP_001074400Link to BLAST:NP_001074400.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074400.1 2171 Q5SWW4 2171 100% 0 0

Chromosomal Locations for CCDS 36267.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 86270986 86271118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86272463 86272563 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86275374 86275547 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86276820 86276968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86278470 86278655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86278764 86278922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86279593 86279735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86283200 86283423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86283751 86283942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86285113 86285332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86286434 86286890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86288091 86288280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86288933 86289156 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86291043 86291204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86298280 86299196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86300650 86300846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86301130 86301344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86301465 86301555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86303534 86303655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86306984 86307062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86308699 86308912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86319348 86320031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86327802 86327912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86328447 86328609 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86329168 86329362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86330988 86331185 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86331883 86332028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86345860 86346028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86355274 86355508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 86357460 86357525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6516 nt):
ATGAGTTCCTCCTTCGTGTCGAACGGGGCCAGCCTGGAAGATTGTCACTGTAACCTCTTCTGCCTGGCCG
AC
TTGACAGGAATTAAGTGGAAAAGATATGTATGGCAAGGCCCAACTTCCGCCCCTATTCTGTTTCCGGT
G
ACAGAAGAAGACCCCATTTTGAGCAGTTTTAGTCGATGCCTTAAGGCAGATGTACTTGGTGTTTGGCGG
CGA
GATCAAAGACCTGGAAGAAGAGAATTGTGGATATTTTGGTGGGGTAAAGATCCCAATTTTGCTGACC
TT
ATTCACCATGACTTATCAGAAGAGGAAGATGGAGTATGGGAGAATGGCCTTTCCTATGAATGCCGTAC
T
TTGCTTTTCAAAGCAGTTCACAATCTGTTGGAGCGATGTTTGATGAACCGAAACTTTGTACGAATTGGC
AAG
TGGTTTGTGAAGCCATATGAGAAAGATGAAAAACCTATAAATAAAAGTGAACACTTGTCCTGCTCTT
TC
ACCTTTTTCTTGCATGGAGACAGCAATGTTTGTACCAGTGTGGAAATTAACCAACATCAACCTGTATA
C
CTTCTCAGTGAAGAGCATGTCACCCTTGCTCAACAGTCTAATAGCCCATTTCAAGTTATCTTAAGTCCA
TTT
GGACTAAATGGCACTCTCACGGGACAGGCTTTCAAGATGTCTGATTCAGCTACGAAAAAATTAATTG
GT
GAATGGAAACAGTTCTATCCTATTTCATGTGGTTTGAAGGAGATGTCTGAGGAGAAACAGGACGATAT
G
GATTGGGAAGACGATTCTTTGGCTGCGGTGGAAGTTCTTGTTGCGGGTGTCCGAATGATCTACCCAGCA
TGC
TTTGTGCTAGTCCCTCAGTCAGACATTCCTGCTCCTAGCTCTGTGGGAGCTTCTCACTGTTCAGCTT
CT
TGCTTGGGTATCCATCAAGTGCCTGCTTCCACAAGAGATCCTGCTATGTCTTCAGTTACTCTCACTCC
A
CCTACATCTCCTGAGGAAGTCCAAACAGTTGATCCTCAGTCCGCACAGAAGTGGGTCAAATTTTCTTCA
GTA
TCCGATGGCTTCAGCACTGACAGTACTAGCCATCATGGTGGGAAAATACCCAGAAAATTAGCAAATC
AT
GTGGTGGATAGAGTCTGGCAAGAATGTAATATGAACAGATTACAGAACAAGAGGAAGTATTCTGCTAC
A
TCCAGCGGCCTGTGTGAGGAAGAGACTGCCGATAAAATAGGATGCTGGGACTTTGTTGAAGCCACACAA
AGA
ACAAGCTGCAGTTGTTTGAGGCATAAAAGTCTCAAGACAAGAAATACTGGGCAACAAGGACAGGCAC
CA
TCTTTAGGGCAGCAACAGCAAGTACTTCCTAAGCACAAGACCAATGAGAAGCAAGACAAGAGTGAGAA
G
CCACAGAAGCGCCCCTTGACTCCCTTTCACCATCGTGTATCAGTTAGTGATGAGATTGGCATGGACACA
GAT
TCAGCCAGCCAAAGACTTGTGATCTCTGCTGCAGATAGTCAAGTGAGGTTTTCAAACATCCGAACTA
AT
GATGTAGCAAAGACTCCTCAGATGCATGGCACTGAACTGGCAAATTCACCTCAGCCTCCCCCACTTAG
T
CCTCATCCTTGTGATGTGGTTGATGAAGGAGTGACTAAAACACCTTCAACTCCGCAGAGTCAACATTTT
TAT
CAAATGCCAACACCGGATCCCTTGGTTCCTACCAAACCAATGGAAGATAGGATAGACAGTTTGTCCC
AG
TCTTTCCCACCTCCATTTCAGGAAGCTGTAGAACCTACCGTGTATGTTGGTACAGCAGTAAGCTTGGA
A
GAAGATGAAGCTAATGTAGCCTGGAAGTATTACAAAGTCCCAAAGAAAAAAGATGTAGAATTTTTACCA
CCT
CAACTTCCAAATGATAAATTCAAGGATGATCCAGTTGGACCTTTTGGACAGGAAAGTGTAACATCAG
TT
ACAGAGTTAATGGTGCAGTGTAAGAAGCCTTTAAAAGTTTCTGATGAAATAGTCCAGCAATATCAAAT
T
AAAAATCAGTATCTTTCAGCAATAGCATCTGATACAGAACAAGAACCTAAAATTGATCCATATGCATTT
GTT
GAAGGAGATGAGGAATTCATTTTTACTGATAAAAAAGATAGACAAAATAGCGAGAGAGAAGCTGGGA
AG
AAACACAAGGTGGAAGATGGGACATCTGCTGTCACAGTGTTATCACACGAAGAAGATGCTATGTCATT
A
TTTAGTCCCTCTAAACAAGATGCTCCACGCCCTACAAATCATGCCCGTCCTCCATCAACCAGTTTGATT
TAT
GACTCAGATTTGGCTGTGTCTTACACTGACCTTGATAACCTCTTCAATTCTGATGAAGATGAATTAA
CA
CCTGGATCTAAAAAGTCAGCAAGTGGATCAGATGATAAAGCCAGCTCCAAAGAATCAAAGACAGGAAA
T
CTGGATCCGTTGTCCTGCATAAGCACTGCAGACCTCCACAAAATGTACCCCACGCCACCCTCACTGGAA
CAG
CACATTATGGGCTTCTCTCCAATGAATATGAATAACAAAGAATACGGTAGTGTGGACACAGCACCCG
GA
GGGACTGTCCTGGAAGGAAATAGCTCTAGTGTAGGAACGCAGTTCAGAATCGAGGTCGAGGAAGGATT
C
TGTAGCCCTAAACCGTCTGAAATTAAAGATTTTTCTTATGTCTATAAGCCCGAAAATTGTCAAGTTCTA
GTA
GGATGTTCCATGTTTGCACCTTTAAAAACTCTACCAAGCCATTGTCTGCCTCCTATCAAATTGCCAG
AA
GAGTGTGTTTACCGGCAGAGCTGGACTGTTGGAAAATTGGACTTGCTTCCTTCAGGCCCTTCAATGCC
A
TTCATCAAGGAGGGTGATGGCAGTAATTTGGATCAGGACTATGGCCCCGCCTACACACCGCAAACCCAT
GCT
TCTTTTGGGATGCCTCCGAGCAGCGCACCTCCTAGTAATGGTGGTGCAGGAATTCTTCCTTCCCCAT
CC
ACCCCTAGGTTTCCAACTCCAAGGACTCCAAGGACTCCAAGGACCCCTCGTGGGGCTGGTGGGCCTGC
T
AGTGCTCAAGGTTCAGTCAAGTATGAGAATTCAGACTTGTATTCACCAGCTTCCACCCCATCTACATGC
CGA
CCCCTCAATTCTGTTGAACCTGCAACTGTTCCTTCCATCCCTGAAGCGCACAGTCTTTATGTAAACC
TC
ATCCTTTCAGAATCAGTAATGAATTTGTTTAAAGACTGTAATTTTGATAGTTGCTGTATTTGTGTCTG
C
AATATGAATATCAAGGGTGCCGATGTTGGAGTTTACATTCCAGACCCAACCCAAGAAGCACAGTATCGG
TGC
ACCTGTGGCTTCAGTGCTGTCATGAACCGAAAATTTGGAAATAATTCAGGATTATTTCTTGAAGATG
AA
CTTGACATCATAGGACGTAACACAGACTGTGGGAAAGAAGCAGAAAAACGTTTTGAAGCTCTCAGGGC
T
TCCTCTGTGGAGAATGTTAATGGAGGCCTGAAGGAATCTGAAAAGGTGCCTGATGAATTAATATTACTG
CTA
CAAGATCAATGCACTAATTTATTTTCACCCTTTGGAGCAGCAGACCAAGATCCTTTTCCCAAAGTGG
GT
ATAAGTAGCAATTGGGTGCGTGTTGAGGAGCGGGACTGTTGTAGTGACTGCTGCCTCGCCTTAGAACA
T
GGGCGTCAGTTCATGGATAATATGTCAGGAGGGAAAGTTGATGAAGCACTTGTCAGAAGCTCATGCTTA
CAT
CCGTGGGCCAAGCAAAATGATGCGAGCGTGCAGTGTTCACAGGATATACTTCGGATGCTCCTTTCTC
TT
CAGCCAGTTCTTCAAGATGCTATTCAGAAAAAAAGAACAGTGAGGCCTTGGGGTGTTCAAGGTCCTCT
C
ACATGGCAACAATTTCATAAAATGGCTGGCCGAGGCTCTTATGGAACTGATGAATCTCCGGAACCACTG
CCG
ATTCCCACGTTTTTGTTGGGTTATGATTACGATTTTCTGGTGCTTTCTCCATTTGCTCTCCCTTACT
GG
GAGAAACTTATGCTGGAACCCTATGGATCTCAAAGAGATATAGCCTATGTTGTACTCTGTCCAGAGAA
T
GAAGCTTTGTTAAATGGAGCCAGAAGCTTTTTTAGAGATCTCACTGCAATATATGAGTCCTGTCGATTA
GGC
CAACACAGACCTATTTCTCGATTGTTGACGGATGGGATCATGAAAGTGGGAGCTACTGCATCAAAGA
AA
CTTTCAGAAAAGTTTGTAACAGAATGGTTTTCTCAGGCAGCTGATGGTAACAATGAAGCATTTTCCAA
A
TTGAAGCTGTATGCACAAGTCTGCAGATATGATTTAGGTCCATATCTTGCTTCTCAGCCGTTGGACAGC
TCT
CTGCTCTCCCAGCCAAATTTAGTTGCCCCTCCAAATCAGTCTTTGGTTACTGCACCTCAGATGACAA
AT
ACTGGAAACGCTAATGCTCCATCTGCCACCTTAGCATCTGCGGCAAGTAGCACTATGACAATGACTTC
A
GGTGTTCCCATATCTACTTCAGTTGCCACAGCTAATTCAACTTTGACCACAACTTCATCTTCATCATCT
TCC
AGTCTGAGTAGTGGAGTATCATCAAATAAACTGCCTTCGTTTCCACCCTTTGGCAGTATGAACACTA
GT
GGTACAGGATCCATGTCTGCACAAGCAAGTACGGTTCAGAGTGGCCAGCTAGGAGGACAGCAGTCGTC
A
TCTCTGCAGGCAGCAGGAATATCAGGGGAGTCAGCTTCTCTTCCCACTCAGCCACATCCTGATGTGTCT
GAA
AGCACAATGGATCGTGATAAAGTGGGGATTCCCACAGATGGTGATTCACATGCAATTACCTACCCTC
CT
GCAATTGTTGTTTATATAATCGATCCTTTTACATATGAAAATAAAGACGAGAGCACTAACTCTTCTAA
T
GTATGGACTTTGGGGCTCCTTCGATGCTTCTTGGAAATGGTCCAAACTCTTCCTCCTCATATCAAGAGC
ACT
GTTTCTGTGCAGATTGTTCCTTGTCAGTACCTGTTACAACCTGTGAAACACGACGACAGACAGATCT
AC
TCCCAGCATTTAAAATCTTTGGCTTTTTCGGTGTTTACCCAGTGTCGGAGACCACTTCCAACATCAAC
C
AATGTAAAAACACTGACTGGGTTTGGTCCAGGCTTAGCTATGGAAACTGCTCTTAAAAGTCCTGATAGA
CCA
GAGTGTATTCGACTTTATACACCACCTTTTATTCTGGCTCCGGTGAAGGACAAACAAACAGAGCTAG
GA
GAGACCTTTGGAGAAGCTGGACAGAAATACAATGTTCTTTTTGTGGGCTACTGTTTATCACATGATCA
A
AGGTGGATTCTTGCATCTTGCACAGATCTATATGGAGAACTCCTAGAAACATGTATCATTAACATCGAT
GTT
CCAAATAGGGCCCGTCGGAAAAAGGGTTCTGCTAGAAGATTTGGTCTACAGAAACTGTGGGAGTGGT
GC
TTGGGACTTGTTCAGATGAGCTCTTTACCATGGAGAGTTGTGATTGGTCGCCTGGGAAGGATTGGACA
T
GGAGAGTTGAAAGATTGGAGTTGTTTGCTGAGTCGTCGAAACTTGCAATCTCTAAGCAAAAGGCTCAAA
GAC
ATGTGTAGGATGTGTGGCATATCTGCTGCAGACTCTCCAAGTATCCTTAGTGCTTGTTTGGTTGCAA
TG
GAACCCCAAGGTTCTTTTGTTATCATGCCAGATTCTGTGTCAACTGGTTCTGTTTTTGGAAGAAGTAC
C
ACTCTAAATATGCAGACGCCTCAGCTAAATACCCCACAAGATACATCCTGTACTCATATACTTGTGTTC
CCT
ACTTCTGCTTCTGTGCAAGTAGCTTCAGCTACTTACACCACTGAAAATTTGGATTTAGCTTTCAATC
CC
AACAATGATGGAGCAGACGGAATGGGTATCTTTGATTTATTAGACACAGGAGATGATCTTGATCCTGA
T
ATCATTAATATCCTTCCTGCATCTCCAACTGCATCTCCTGTACATTCTCCAGGCTCTCATTACCCCCAT
GGA
GGTGATGCTGGCAAGGGTCAGGGTACTGATCGGCTACTTTCAACAGAATCGCATGATGAAGTAACTA
AT
ATTCTTCAACAACCATTGGCCCTTGGATACTTTGTATCAACTGCCAAAGCGGGTCCATTACCTGACTG
G
TTCTGGTCAGCATGCCCTCAAGCACAATATCAATGCCCCCTTTTTCTTAAGGCCTCTTTGCACCTCCAC
GTG
CCTTCAGTGCAATCTGACGAGCTGCTTCACAGCAAACACTCCCACCCACTGGACTCAAATCAGACTT
CA
GATGTCCTCAGGTTTGTTTTGGAACAGTACAATGCACTCTCATGGCTAACCTGTGACCCTGCAGTCCA
G
GACAGACGCTCATGTCTCCCAGTTCATTTTGTGGTGCTGAATCAGTTATATAACTTCATCATGAATATG
CTG
TGA


Translation (2171 aa):
MSSSFVSNGASLEDCHCNLFCLADLTGIKWKRYVWQGPTSAPILFPVTEEDPILSSFSRCLKADVLGVWR
R
DQRPGRRELWIFWWGKDPNFADLIHHDLS
EEEDGVWENGLSYECRTLLFKAVHNLLERCLMNRNFVRIG
K
WFVKPYEKDEKPINK
SEHLSCSFTFFLHGDSNVCTSVEINQHQPVYLLSEEHVTLAQQSNSPFQVILSP
F
GLNGTLTGQAFKMSDSATKKLIGEWKQFYPISCGLKEMSEEKQDDMDWEDDSLAAVEVLV
AGVRMIYPA
C
FVLVPQSDIPAPSSVGASHCSASCLGIHQVPASTRDPAMSSVTLTPPTSPEEVQT
VDPQSAQKWVKFSS
V
SDGFSTDSTSHHGGKIPRKLANHVVDRVWQECNMNRLQN
KRKYSATSSGLCEEETADKIGCWDFVEATQ
R
TSCSCL
RHKSLKTRNTGQQGQAPSLGQQQQVLPKHKTNEKQDKSEKPQKRPLTPFHHRVSVSDEIGMDT
D
SASQRLVISAADSQVRFSNIRTNDVAKTPQMHGTELANSPQPPPLSPHPCDVVDEGVTKTPSTPQSQHF
Y
QMPTPDPLVPTKPMEDRIDSLSQSFPPPFQEAVEPTVYVGTAVSLEEDEANVAWKYYKVPKKKDVEFLP
P
QLPNDKFKDDPVGPFGQESVTSVT
ELMVQCKKPLKVSDEIVQQYQIKNQYLSAIASDTEQEPKIDPYAF
V
EGDEEFIFTDKKDRQNSEREAGKKHK
VEDGTSAVTVLSHEEDAMSLFSPSKQDAPRPTNHARPPSTSLI
Y
DSDLAVSYTDLDNLFNSDEDELT
PGSKKSASGSDDKASSKESKTGNLDPLSCISTADLHKMYPTPPSLE
Q
HIMGFSPMNMNNKEYGSVDTAPGGTVLEGNSSSVGTQFRIEVEEGFCSPKPSEIK
DFSYVYKPENCQVL
V
GCSMFAPLKTLPSHCLPPIKLPEECVYRQSWTVGKLDLLPSGPSMPFIKE
GDGSNLDQDYGPAYTPQTH
A
SFGMPPSSAPPSNGGAGILPSPSTPRFPTPRTPRTPRTPRGAGGPASAQGSVKYENSDLYSPASTPSTC
R
PLNSVEPATVPSIPEAHSLYVNLILSESVMNLFKDCNFDSCCICVCNMNIKGADVGVYIPDPTQEAQYR
C
TCGFSAVMNRKFGNNSGLFLEDELDIIGRNTDCGKEAEKRFEALRASSVENVNGGLKESEKVPDELILL
L
QDQCTNLFSPFGAADQDPFPKVGISSNWVRVEERDCCSDCCLALEHGRQFMDNMSGGKVDEALVRSSCL
H
PWAKQN
DASVQCSQDILRMLLSLQPVLQDAIQKKRTVRPWGVQGPLTWQQFHKMAGRGSYGTDESPEPL
P
IPTFLLGYDYDFLVLSPFALPYWEKLMLEPYGSQRDIAYVVLCPENEALLNGARSFFRDLTAIYE
SCRL
G
QHRPISRLLTDGIMKVGATASKKLSEKFVTEWFSQAADGNNEAFSKLKLYAQVCRYDL
GPYLASQPLDS
S
LLSQPNLVAPPNQSLVTAPQMTNTGNANAPSATLASAASSTMTMTSGVPISTSVATANSTLTTTSSSSS
S
SLSSGVSSNKLPSFPPFGSMNTSGTGSMSAQASTVQSGQLGGQQSSSLQAAGISGESASLPTQPHPDVS
E
STMDRDKVGIPTDGDSHAITYPPAIVVYIIDPFTYENKDESTNSSNVWTLGLLRCFLEMVQTLPPHIKS
T
VSVQ
IVPCQYLLQPVKHDDRQIYSQHLKSLAFSVFTQCRRPLPTSTNVKTLTGFGPGLAMETALKSPDR
P
ECIRLYTPPFILAPVKDKQTELGETFGEAGQKYNVLFVGYCLSHDQRWILASCTDLYGELLETCIINID
V
PN
RARRKKGSARRFGLQKLWEWCLGLVQMSSLPWRVVIGRLGRIGHGELKDWSCLLSRRNLQSLSKRLK
D
MCRMCGISAADSPSILSACLVAMEPQGSFVIMP
DSVSTGSVFGRSTTLNMQTPQLNTPQDTSCTHILVF
P
TSASVQVASATYTTENLDLAFNPNN
DGADGMGIFDLLDTGDDLDPDIINILPASPTASPVHSPGSHYPH
G
GDAGK
GQGTDRLLSTESHDEVTNILQQPLALGYFVSTAKAGPLPDWFWSACPQAQYQCPLFLKASLHLH
V
PSVQSDELLHSKHSHPLDSNQTSDVL
RFVLEQYNALSWLTCDPAVQDRRSCLPVHFVVLNQLYNFIMNM
L




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser