NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36218.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36218.1 Public Mus musculus 11 Zzef1 21 106 86 CCDS HistoryNCBI Gene:195018Re-query CCDS DB by CCDS ID:36218.1Re-query CCDS DB by GeneID:195018See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 36218.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000069395 ENSMUSP00000068790 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000069395Link to Ensembl Protein Viewer:ENSMUSP00000068790Re-query CCDS DB by Nucleotide ID:ENSMUST00000069395Re-query CCDS DB by Protein ID:ENSMUSP00000068790
Original member Current member NCBI NM_001045536.2 NP_001039001.1 Accepted alive Link to Nucleotide Sequence:NM_001045536.2Link to Protein Sequence:NP_001039001.1Re-query CCDS DB by Nucleotide ID:NM_001045536Re-query CCDS DB by Protein ID:NP_001039001Link to BLAST:NP_001039001.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001039001.1 2891 Q5SSH7-2 2891 100% 0 0

Chromosomal Locations for CCDS 36218.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 72796297 72796650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72817931 72818075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72821755 72821949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72823380 72823551 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72824075 72824274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72826052 72826262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72830578 72830694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72831543 72831721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72837183 72837281 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72843256 72843347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72844339 72844487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72848642 72848753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72850559 72850771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72851834 72851934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72853159 72853328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72855383 72855516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72858331 72858401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72859582 72859696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72863875 72864034 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72864736 72864857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72864957 72865079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72865825 72865991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72866072 72866153 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72866604 72866805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72867922 72868070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72869687 72869927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72872604 72872683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72873864 72873957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72874898 72875360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72876556 72876720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72880571 72880690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72881216 72881377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72884342 72884471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72886634 72886772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72888143 72888308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72888997 72889259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72891092 72891225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72893262 72893412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72895146 72895285 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72899504 72899694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72900632 72900806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72901327 72901459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72906832 72907031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72908394 72908513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72910130 72910321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72911162 72911262 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72912823 72912958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72913051 72913410 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72915217 72915315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72916473 72916587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72917169 72917267 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72917704 72917869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72922330 72922483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72923110 72923181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72924637 72924717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (8676 nt):
ATGGGGAACGCTCCGAGTAACAGCAGCGAAGACGAAGCGGCGGCCGCAGGGGGTGAGGGCTGGAGCCCAC
AT
CAAGATTGGGCTGCCGACTCTGGCACGACCCCCGGCCCCGGCCCTGCGGCCGCGGTGCTGCCTTCCGC
C
GCTGCACTCCTGGAACCCGCTCGGCTGCGAGAGGCAGCGGCTGCGTTGCGGCCCGCACCTCCCTGCGAA
TCC
CTGGTGTCGAGGCACCACGGCGCGCTCTTGCGCTGGCTGGAAGAGCGGCTGGGCCGCGGTGAAGAGT
CC
GTCACCCTGGAGCAGTTCCGGGAGTTGCTGGAGGCTCGCGGCGCTGGATGTTCGGGCGAGCAGTTCGA
G
GAGGCCTTTGCCCAGTTTGATGCTGAGGGAGATGGGACAGTTGATGCTGAGAATATGCTGGAGGCCCTC
AAG
AACTCCAGTGGAGCCAATCTTCAGGGGGAGCTGAGCCATGTCATCAGACAACTGCAAGCCTGCTCTC
TT
GTTCCAGGTTTCATCGACATATTTTCAGAGTCAAAGGAGGGCCTTGGCATTCACTCATCAATGATATT
G
CGCTTCCTGCATCGCAATCGGATCTCTAGCATGGTGATTCCCTACCCAATGTTAGACCACTGTAATAAC
ATG
TGCACCATGAGATCATCAGTTCTGAAGGAGTCTCTGGATCAACTGGTACAAAAAGAAAAGGAAAGCC
CT
GGAGATCTAGCCAGAAGCCCAGAGATGGATAAGCTCAAGTCAGTAACCAAGTGTTATGCTTATATAGA
A
ACGTCCTCCAACCCTGCAGACATATACAGGATGACAAATGGAGAAACATCATCCTACTGGCAGTCAGAT
GGC
AGTGCGCGCTCACACTGGATACGTTTGAAGATGAAGCCAGATGTTGTGCTTAGGCATCTGTCCATTG
CA
GTGGCTGCCACTGACCAGAGCTACATGCCACAGCAGGTGACAGTGGCTGTGGGAAGGAGTGCCAGTGA
C
CTGCAGGAAGTTCGTGATGTGCACATCCCCAGCAATGTCACTGGCTATGTGACACTGCTAGAAAATGCC
AAC
ATCAGTCAGCTCTATGTCCAGATAAACATAAAGCGTTGTCTTAGCGACGGATGTGACACTAGGATTC
AC
GGTCTGAGGGCTGTTGGCTTTCAGAGAGTAAAGAAATCTGGAGTCTCTGTCTCTGATGCCTCTGCAAT
A
TGGTATTGGTCTCTGCTGACATCTTTGGTGACAGCGTCTATGGAGACAAATCCTGCCTTTGTCCAGACA
GTG
CTGCACAATACTCAGAAGGCACTGCAGCACATGCCACCGCTGTCCCTCTCTCCAGGATCTACGGACT
TC
TCAACTTTCCTCTCTCCTAATGTTCTGGAAGAAGTGGACAGCTTCCTCATAAGGATAACTAGCTGCTG
T
TCTACTCCAGAGGTAGAGCTGACTCTTCTGGCTTTTGCACTAGCAAGAGGAAGTATTGCCAAAGTAATG
AGC
TCTCTGTGTACCATCACTGACCACTTGGACACACAGTATGACGCCTCATCCCTCATCTCATCCATGG
CA
TCTGTCAGGCAGAACCTGCTCCTGAAATATGGTAAGCCTCTCCAGTTGACTCTTCAGGCTTGTGATGT
T
AAAGGAAAAGAAGATAAGTCAGGACCTGAAAATCTTCTTGTGGAGCCATGGACAAGGGATGGTTTTCTT
ACA
GAGACTGGAAAAACGAGAGCAAGTACTATTTTTTCTACAGGAAGTGACTCTGCCTTCCAAGTTACAC
AG
ATCAGAATTATGGTTCGCCGTGGTGGCATTGGTGCTCAGTGTGGGCTGGTCTTTGCCTATAACTCGCC
T
TCTAATAAGTTTCACGCAGAAGAACACTTCAAACGGTTTGAAAAATATGACAAATGGAAACTCCAGGAA
CTG
AGGCAGTTCGTAAAAAGCAGGATTGGTTGCTCATCTGATGACCTTGGAGAGGATGATCCTATTGGCT
GG
TTTGAGCTAGAAGAAGAGTGGGATGAAGCAGATGTCAAGTTACAACAGTGCAGAGTTGCCAAATTCTT
G
ATGGTGAAGTTCCTCTGCACCCGCCAGGAGTCAGCTGAACGGTTGGGCGTGCAAGGCTTAAGCATCAGT
GGG
TACCTCCGGCCTGCAAGGGCAGAAGCGGAACAAAGCATCCTCTATGCCCACTGTAGAAGGGACACAG
AG
AATATTCATGGGGCCACCCTGCTTCTTAGGACTCTGCAGTTCATCCAGCAGCTTTCCCATGACCTGAT
G
CAGCAAAAGGAAAGTGGCTTAAAACATAAGTCTTTCCTGGACTTTGCGGGTCTTGATTTGCAGATCTTC
TGG
AAATTTTACAGTAAATTAAAGCAAAACCGAAGGGAAGAATGTATCTGTGCACAGACCCTTCTGCTGA
AG
CTCCTGCAGAGCTGCTTCTCAGTGCTGCAGGGTGACCCACAAGCTGCCTCAGAGGAGGAGAAGCCTAC
A
GCGCAACGCTCTGAGGGAATACAGGCTGCCAAGGAGCTCTACACACACTTATGTAATGTGGTAGATAAA
CCT
AATGGAAATTCCATGCCCATGGAGATCCTAAAACAAGAAGTGAGAAACACTCTTCTCAATGGGGCTG
CC
ATCTTCTTTCCTGATCGACAGACCCGGAGAAGCCAGCTCTTCACCATGATGAAGAGTGTCACTGAGCA
C
GAACGCAAGCAGTCTCTGCAACTCACTTTCCATTCACTCTGCACATATTTTAGTGATAAGGATCCAGGA
GGC
CTTCTGCTTTTACCTGAGAAGAGTGACCTGGCCACCATGAACACCAGTGAAGTCCTGGCTGTCATGA
AC
ACCCTCCTCTCTGTTGCTGCTCGAGAGTGTGAATTGTTGATGCTCAATCGGTCCCATGGGGCAGTTGG
T
TCTGTACTCTTCTCCCTGTTCTGGTCTGTGCAAGGCAGCCTGCTCTCCTGGTGCTTCCTGCAGCTCAAG
AGC
ACAGATGCTGCAGCCAAAGAGCTCGCCATGGATCTTATTGAAAAATATGTGGGGCAGTTTCTGGCAA
GC
ATGAGAGTGATTTTGGAGTCCCTTTTGTCACAGTATAGTGGAAAGACCATAGTAGAAAAATTATGCAA
T
TCGGTGTTTTCCATGGCAGCTCGTCAACTGGTCATCTTCCTGCTAGACTTCTGCACTTTAGACGTGTCC
CAC
TGCACACTCCTAAGAGAGTTCAGCACCCTCACAGAGCTGTTGAAGAAGCTGTGCAGTGACCCTGAAG
GA
GGCCTGAGCAAGTTGGATGTGGAGACCTGGCAGCAGGAGCAGCCTGTGGTATTGCATACCTGGACCAA
G
GAATCCACCCACAACTATGAAAATAACTGCCATGAAGTGTCTGTCTTTATTAGCCCAGGAGCAACTTAT
TTT
GAGGTGGAATTTGATGAGAGGTGTGAGACTGAGAAAAGGTACGATTATTTGGAATTTACTGACTCTA
GA
GGTGGGAAGACACGCTATGACACCAAAGTTGGGACTTATAAATGGCCCAAGAAAGTGACCTTTAAGGA
T
GGCCCTCGGCTGCAGTTCCTCTTTCATTCTGACAGCAGTAACAATGAGTGGGGCTACAAGTTCACTGTC
ACT
GCCTATGGTCTGCCTGATGTTGCTGTGTCTTGGGGTTTGGACTTGCAACTCCTTGTCTCCCGACTGA
TG
GGGCGCCTTGCTTCCCAGTGCATGGCACTCAAGTCAGTGCATCAGTTAGGCAGTAACATGGCAGTATC
C
CAGGCAAAACTGACTTCAGTCCTGAACTCTCCATTGTGGAAACCTGTCTTCAGGCATCAGATTTGTCCA
GAG
TTGGAATTGGAAGCAAGCTGGCCCACTCACCCACACAAGGATGGGAAGGAGGTCAAGAACATCCCTG
AT
GATCCCTGCCGCCATTTTCTCCTTGATTTTGCCCAGTCAGAGCCTGCTCAGAACTTCTGTGGGCCATA
T
TCAGAACTTTTCAAAGGATTCATACAGGCATGTAGAAAACAGGCCCCAAAGACAGATATAGTTGCTGGT
TCC
ACTATTGATCAAGCTGTGAACGCCACCTTTGCCGCTCTGGTGTATCGCACTCCAGACTTATATGAGA
AG
CTGCAAAAATATGTTAACAGCGGTGGCAAGATAGCCCTGACTGAGGAGTTCTCTCAGGTGTATTCCCT
G
GCAGATGGGATTCGAATATGGATGTTAGAGATGAAGCAGAAGTCCTTGCTGAGCCTGGGGAATGATTCA
GAA
GAAAAACGTGGTTTGGAAGCTGCAGAGGTGAACCCAGAGAGCCTGGCAAAAGAATGTATTCAAAAAA
GT
CTGTTATTACTGAAATTTTTGCCCATGAGCAAAAGTTCAAAAGAAAACTGTGACAAGTTGGAAACTGT
C
GATGAAACTGATCATCTCCAGCCACTTGATAGACGCCAGAGGACAAGCTCTGTGGTGGAAGAACATTTC
CAG
GGTTCAGCATCTCCTACAGAAGCAGCCACCCCAGCTGCAGGTGACAGGAGTCCTGCCTTAGAGATCC
AG
CCAAAGCTACTACCCAGTAGTGGCCCCTGTGTTGCAGAAGTGTCCACAGCTGAAGAGCCCTCACCACC
A
TCCACACCCACCCGGAGGCCTCCTTTCACCCGAGGGCGACTCCGGCTGCTCTCTTTCAGATCCATGGAA
GAG
ACCAGGCCAGTCCCCACAGTCAAGGAGAAATACCCGGTGCTGAAGGATGTCATGGACTTCATTAAAG
AC
CAGTCACTCTCACACGAGAGTGTTGTGAAGGTTCTTTCTTTGCGGAAAGCCCAAGGGCAGAGCATACT
T
GAAGTCCTGAGGATAATTCAGTATTGCACAGAATCCCTCGGGCAGCCTCACTGCTTCCACCCACCGTAT
ATA
CTTTTCCTACTGGAACTTCTGACCTGCCAGAAAGATTTTACAAATTACTTTGGACACTTGGAAGGCT
GT
GGTGCTGATCTACACAGAGAAATCCGAGACACTTACTATCAACTTGTTCTGTTTTTGGTCAAAGCAAT
C
AAAAGATTTAGTAGCATAAATGACAGGTCTCTGCTCCCTGCTTTATCTTGTGTCCAGACAGCCCTGCTT
CAT
CTTTTGGATATGGGCTGGGAACCCAGTGATCTTGCCTTCTTTGTTGACATTCAGTTACCAGATCTCC
TC
ATGAACATGTCCCAAGAAAACATCAGTGTCCATGACAGTGTGATTAGCCAGTGGAGTGAAGAAGATGA
A
CTCGCTGATGCCAAGCAGAACTCAGAGTGGATGGATGAGTGTCAGGATGGCATGTTTGAGGCCTGGTAT
GAA
AAAATAGCCCAAGAGGATCCAGAGAAGCAGAGGAAAATGCACATGTTTATTGCTCGATACTGTGACC
TG
TTAAATGTGGATATCTCTTGTGATGGGTGTGATGAGATTGCCCCCTGGCATCGATACCGATGTCTACA
G
TGCAGTGACATGGACCTCTGCAAGACTTGCTTCCTTGGTGGAGTGAAGCCCGAGGGCCATGGAGACGAT
CAT
GAAATGGTTAACATGGAGTTTACGTGTGACCACTGCCAGGGTTTGATCATAGGCCGGAGAATGAATT
GC
AATGTATGTGATGACTTTGATCTTTGCTATGGATGCTACACAGCAAAGAAATACTCCTATGGCCATTT
G
CCAACTCACAGCATCACAGCCCATCCAATGGTGACCATCCGCATCAGTGACCGGCAGAGGCTCATCCAG
CCC
TATATCCACAACTACTCCTGGCTGCTCTTTGCTGCCCTGGCTCTCTATAGTGCCCACCTGACCAGTA
CA
GAGCAGGTGGATGGGGAGCAGCTGGACCCCCAGGCCCGCACCAATGCTGCCACCCTGAGGAGCCAGTG
C
ATGCAGCTGGTTGGGGACTGTCTGATGAAGGCCCACCAGGGCAAAGGTCTTAAAGCTCTGGCTCTTCTT
GGT
GTATTGCCAGATGGTGACTCTACCTCAGAAAATCAAGCCCTGCCAGTCACAGTGTCCTTCCAGGCAT
CA
GAGGAGCAGGCAGATGCAGGCCTGTTGGTACCCTGCAACGGAAAGAGAGCTGCAGATACGGAAGTAAG
A
CCCTTGGATTATAAGCAGAAGAAAAAGGCAGGTGAAGATCTCTCCATAGTGAAGGACCCTTCATGCCAG
ACC
CAGGTTTCAGATGCACCTGCCAGTGCTCACGTGCCTCCAGGACTTCCAGATGCTGAACATCCAGAAG
TG
TCAGCTCAGGTACTGGTAGAAGAGAAGGCGATTACTCCAAACCCTGAGCAAGTGTTTGCAGAGTGTTC
C
CAGAAGAGGATTTTGGGATTGCTGGCAGCCATGTTACCTCCCATCAAGTCGGGTCCCACAGTCCCCCTG
ATA
GATCTGGAGCACGTCCTCCCACTCATGTTTCAGGTGGTCATCTCCAACGCAGGCCACCTGAATGAAA
CC
TACCACCTCACCCTGGGTCTTCTGGGCCAGTTAATTATCCGTCTTCAGCCAGCAGAAGTAGATGCTGC
A
GTCATGAAGGTCCTTTCAGCCAAGCACAACCTCCGAGTGGGCCTGGACTGGGCCTGCTCCATGGCAGAG
ATC
CTTCGGTCACTCAACAATGCCCCGTTGTGGCGAGATGTCATTGCCACCTTCACAGACCACTGCATCA
AG
CAGCTGCCATTCCAACTGAAGCACACCAACATCTTCACTCTGCTGGTGCTTGTCGGCTTCCCCCAGGT
C
CTCTGCGTGGGAACCCGCTGTGTTTATATGGATAATGCCAATGAACCCCATAATGTGATCATCTTGAAA
CAC
TTCACTGAGAAGAATAGAGCTGTGATTGTCGACGTCAAAACAAGGAAAAGGAAAACAGTGAAGGACT
AT
CAGCTTGTCCAGAAGGGAGGAGGACAAGAGTGTGGCACCTCTCAGTCCCAGCTGAGCCAGTACTCCCA
G
CACTTTGCCTTTATTGCTAGTCACCTTCTGCAAACCAGCATGGATAGCCATTGTCCCGAGGCAGTGGAA
GCA
ACCTGGGTCCTGTCCCTGGCTCTCAAAGGTTTATATAAAACACTAAAGGCTCATGGTTTTGAAGAGA
CC
CATGCCACCTTCCTCCAGACCGATCTGCTAAAGCTGCTGGTGAAGAAGTGCAGCAAAGGGACCGGCTT
C
AGTAAAACCTGGCTCCTCCGAGACCTAGAGATTCTGTCCATCATGCTGTACTCGTCAAAAAAGGAGATC
AAC
ACTCTGGCTGAACATGGAGACCTGGAGCTAGATGAACGAGGAGACCAAGAAGAAGAACTGGACCGGC
CA
GTTAGTAGCCCTGGCGAAGCAGAACAGAAGAAGCTAGACCCTCTTGAAAATTTGGATGAACCCACCAG
A
ATATGCTTCTTGATGGCTCATGATGCCCTCAATGCCCCTCTGCACATTCTCCGGGCCATATATGAACTG
CAG
ATGAAAAAGACTGATTCGTTCTTCCTAGAGGTTCAGAAGAGGTTTGATGGGGATGAGCTCACTACAG
AT
GAGAGGATTCGCTCCTTGGCCCAGAGGTGGCAACCCAGCAGGAGTCTGAGGCTGGAGGAGCAGAGCGC
C
AAAGCTGTGGACACAGACATGATTATCTTGCCATGCTTGTCCCGGCCTGCACGCTCTGACCAAGCCACT
CCT
GAATCAAATCCTGTGACCCAGAAGCTGATTTCCAGCACAGAGAGCGAGCTACAGCAGAGCTATGCCA
AG
CAGCGCCGGAGCAAGAGTGCTGCCCTCCTGCACAAGGAGCTGAACTGCAAGAGCAAGCGGGCTATCCG
G
GACTACCTCTTCCGTGTGAACGAGGCCACCTCAGTCCTATATGCTCGCCATGTGCTCGCCTCCCTGCTG
GCC
GAGTGGCCAGGGCATGTGCCAGTGAGTGAGGACATCCTGGAGCTTAGTGGCCCTGCACATATGACCT
AC
ATTCTGGATATGTTCATGCAGCTGGAAGAAAAGCACCAGTGGGAGAAGATCCTACAGAAAGTACTCCA
G
GGCTGCCGAGAGAACATGCTGGGCACCATGGCCTTGGCTGCCTGTCAGTTCATGGAGGAACCAGGAATG
GAG
GTGCAATGCAACACTGAGGAAGGCTGTGATGAACTAGCCATGTCCAGCAGTAGTGACTTTCAGCAGG
AC
CGGCACAACTTCAGCGGGTCGCAACAGAAGTGGAAAGATTTTGAGCTTCCAGGAGATACTCTGTATTA
C
CGATTTACCTCGGACATGAGCAACACTGAGTGGGGATACCGATTCACTGTGACAGCTGGACATCTGGGG
CGG
TTCCAGACAGGGTTTGAGATCTTGAAGCAGATGTTGTCTGAAGAAAGGGTTGTACCTCACCTCGCAT
TG
GGCAAGATCTGGGAATGGCTGGTGGGTGTGGCCTGCCGCCAAACCGGTCATCAGCGCCTGAAAGCCAT
C
CACTTACTACTGAGGATTGTGCAATGCTGCAGCCACAGTGACCTCTGTGATCTTGGGCTGTTGAAGCCC
CTG
TGGCAGCTCTTTACTCACATGGAGTATGGCCTGTTTGAGGATGTGACACAGCCTGGCATTCTCCTTC
CC
CTACACCGAGCCCTTACTGAGCTCTTCTTTGTCACCGAGAACCGTGCCCAGGAGCTTGGCCTGCTTCA
G
GAGTACCTGCTGGCCTTAACCACCGAGGACCACCTTCTCCGATGTGCAGCACAGGCTCTGCAGAACATT
GCT
GCTATCAGCCTGGCCATCAACTACCCAAACAAGGCCACCCGCCTCTGGAATGTTGAGTGTTAG


Translation (2891 aa):
MGNAPSNSSEDEAAAAGGEGWSPHQDWAADSGTTPGPGPAAAVLPSAAALLEPARLREAAAALRPAPPCE
S
LVSRHHGALLRWLEERLGRGEESVTLEQFRELLEARGAGCSGEQFEE
AFAQFDAEGDGTVDAENMLEAL
K
NSSGANLQGELSHVIRQLQACSLVP
GFIDIFSESKEGLGIHSSMILRFLHRNRISSMVIPYPMLDHCNN
M
CTMRSSVLKESLDQLVQKEK
ESPGDLARSPEMDKLKSVTKCYAYIETSSNPADIYRMTNGETSSYWQSD
G
SARSHWI
RLKMKPDVVLRHLSIAVAATDQSYMPQQVTVAVGRSASDLQEVRDVHIPSNVTGYVTLLENA
N
ISQL
YVQINIKRCLSDGCDTRIHGLRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQT
V
LHNT
QKALQHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFALARGSIAKVM
S
SLCTITDHLDTQYDASSLISSMASVRQNLLLKY
GKPLQLTLQACDVKGKEDKSGPENLLVEPWTRDGFL
T
ETGKTRASTIFSTGSDSAFQVTQIRIM
VRRGGIGAQCGLVFAYNSPSNKFHAEEHFKRFEKYDKWKLQE
L
RQFVKS
RIGCSSDDLGEDDPIGWFELEEEWDEADVKLQQCRVAKFLMVKFLCTRQESAERLGVQGLSIS
G
YLRPARAEAEQSILYAHCRRDTENIHGATLLLRTLQFIQQLSHDL
MQQKESGLKHKSFLDFAGLDLQIF
W
KFYSKLKQ
NRREECICAQTLLLKLLQSCFSVLQGDPQAASEEEKPTAQRSEGIQAAKELYTHLCNVVDK
P
NGNSMPMEILKQEVRNTLLNGAAIFFPDRQTRRSQLFTMM
KSVTEHERKQSLQLTFHSLCTYFSDKDPG
G
LLLLPEKSDLATMNTSEVLAVMNTLLSVAARE
CELLMLNRSHGAVGSVLFSLFWSVQGSLLSWCFLQLK
S
TDAAAKELAMDLIEK
YVGQFLASMRVILESLLSQYSGKTIVEKLCNSVFSMAARQLVIFLLDFCTLDVS
H
CTLLREFSTLTELLKKLCSDPEGGLSK
LDVETWQQEQPVVLHTWTKESTHNYENNCHEVSVFISPGATY
F
EVEFDERCETEK
RYDYLEFTDSRGGKTRYDTKVGTYKWPKKVTFKDGPRLQFLFHSDSSNNEWGYKFTV
T
AYGLPDVAVSWGLDLQLLVSRLMGRLASQCMALKSVH
QLGSNMAVSQAKLTSVLNSPLWKPVFRHQICP
E
LELEASWPTHPHKDGKE
VKNIPDDPCRHFLLDFAQSEPAQNFCGPYSELFKGFIQACRKQAPKTDIVAG
S
TIDQAVNATFAALVYRTPDLYEKLQKY
VNSGGKIALTEEFSQVYSLADGIRIWMLEMKQKSLLSLGNDS
E
EKRGLEAAEVNPESL
AKECIQKSLLLLKFLPMSKSSKENCDKLETVDETDHLQPLDRRQRTSSVVEEHF
Q
GSASPTEAATPAAGDRSPALEIQPKLLPSSGPCVAEVSTAEEPSPPSTPTRRPPFTRGRLRLLSFRSME
E
TRPVPTVKEKYPVLKDVMDFIKDQSLSHE
SVVKVLSLRKAQGQSILEVLRIIQYCTESLGQPHCFHPPY
I
LFLLELLTCQKDFT
NYFGHLEGCGADLHREIRDTYYQLVLFLVKAIKRFSSINDRSLLPALSCVQTALL
H
LLDMGWEPSDLAFFVDIQLPDLLMNMSQENISVHDSVI
SQWSEEDELADAKQNSEWMDECQDGMFEAWY
E
KIAQEDPEKQRK
MHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQCSDMDLCKTCFLGGVKPEGHGDD
H
EMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYTAKKYSY
GHLPTHSITAHPMVTIRISDRQRLIQ
P
YIHNYSWLLFAALALYSAHLTSTEQVDGEQLDPQARTNAATLRSQCMQLVGDCLMKAHQGK
GLKALALL
G
VLPDGDSTSENQALPVTVSFQASEEQADAGLLVPCN
GKRAADTEVRPLDYKQKKKAGEDLSIVKDPSCQ
T
QVSDAPASAHVPPGLP
DAEHPEVSAQVLVEEKAITPNPEQVFAECSQKRILGLLAAMLPPIKSGPTVPL
I
DLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLQPAEVDAAVMKVLSAKHN
LRVGLDWACSMAE
I
LRSLNNAPLWRDVIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQ
VLCVGTRCVYMDNANEPHNVIILK
H
FTEKNRAVIVDVKTRKRKT
VKDYQLVQKGGGQECGTSQSQLSQYSQHFAFIASHLLQTSMDSHCPEAVE
A
TWVLSLALKGLYKTLK
AHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLLRDLEILSIMLYSSKKEI
N
TLAEHGDLELDERGDQEEELDRPVSSPGEAEQKKLDPLENLDEPTRICFL
MAHDALNAPLHILRAIYEL
Q
MKKTDSFFLEVQK
RFDGDELTTDERIRSLAQRWQPSRSLRLEEQSAKAVDTDMIILPCLSRPARSDQAT
P
ESNPVTQKLISSTESELQQSYAKQRRSKSAALLHKELNCKSKRAIRDYLFRVNEATSVLYARHVLASLL
A
EWPGHVPVSEDILELSGPAHMTYILDMFMQLEEKHQWEK
ILQKVLQGCRENMLGTMALAACQFMEEPGM
E
VQ
CNTEEGCDELAMSSSSDFQQDRHNFSGSQQKWKDFELPGDTLYYRFTSDMSNTEWGYRFTVTAGHLG
R
FQT
GFEILKQMLSEERVVPHLALGKIWEWLVGVACRQTGHQRLKAIHLLLRIVQCCSHSDLCDLGLLKP
L
WQLFTHMEYGLFEDVTQPGILLPLHRALTELFFVTENRAQ
ELGLLQEYLLALTTEDHLLRCAAQALQNI
A
AISLAINYPNKATRLWNVEC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser