NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3612.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3612.1 Public Homo sapiens 4 MAPK10 22 109 92 CCDS HistoryNCBI Gene:5602Re-query CCDS DB by CCDS ID:3612.1Re-query CCDS DB by GeneID:5602See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3612.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000395166.6 ENSP00000378595.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395166.6Link to Ensembl Protein Viewer:ENSP00000378595.1Re-query CCDS DB by Nucleotide ID:ENST00000395166Re-query CCDS DB by Protein ID:ENSP00000378595
Original member Current member EBI ENST00000639242.1 ENSP00000491089.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000639242.1Link to Ensembl Protein Viewer:ENSP00000491089.1Re-query CCDS DB by Nucleotide ID:ENST00000639242Re-query CCDS DB by Protein ID:ENSP00000491089
Original member Current member EBI ENST00000639175.1 ENSP00000491160.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000639175.1Link to Ensembl Protein Viewer:ENSP00000491160.1Re-query CCDS DB by Nucleotide ID:ENST00000639175Re-query CCDS DB by Protein ID:ENSP00000491160
Original member Current member EBI ENST00000638225.1 ENSP00000491866.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000638225.1Link to Ensembl Protein Viewer:ENSP00000491866.1Re-query CCDS DB by Nucleotide ID:ENST00000638225Re-query CCDS DB by Protein ID:ENSP00000491866
Original member Current member EBI ENST00000641943.1 ENSP00000492941.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641943.1Link to Ensembl Protein Viewer:ENSP00000492941.1Re-query CCDS DB by Nucleotide ID:ENST00000641943Re-query CCDS DB by Protein ID:ENSP00000492941
Original member Current member EBI ENST00000642103.1 ENSP00000493001.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000642103.1Link to Ensembl Protein Viewer:ENSP00000493001.1Re-query CCDS DB by Nucleotide ID:ENST00000642103Re-query CCDS DB by Protein ID:ENSP00000493001
Original member Current member EBI ENST00000641391.1 ENSP00000493008.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641391.1Link to Ensembl Protein Viewer:ENSP00000493008.1Re-query CCDS DB by Nucleotide ID:ENST00000641391Re-query CCDS DB by Protein ID:ENSP00000493008
Original member Current member EBI ENST00000641724.1 ENSP00000493038.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641724.1Link to Ensembl Protein Viewer:ENSP00000493038.1Re-query CCDS DB by Nucleotide ID:ENST00000641724Re-query CCDS DB by Protein ID:ENSP00000493038
Original member Current member EBI ENST00000642015.1 ENSP00000493040.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000642015.1Link to Ensembl Protein Viewer:ENSP00000493040.1Re-query CCDS DB by Nucleotide ID:ENST00000642015Re-query CCDS DB by Protein ID:ENSP00000493040
Original member Current member EBI ENST00000641803.1 ENSP00000493049.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641803.1Link to Ensembl Protein Viewer:ENSP00000493049.1Re-query CCDS DB by Nucleotide ID:ENST00000641803Re-query CCDS DB by Protein ID:ENSP00000493049
Original member Current member EBI ENST00000641297.1 ENSP00000493092.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641297.1Link to Ensembl Protein Viewer:ENSP00000493092.1Re-query CCDS DB by Nucleotide ID:ENST00000641297Re-query CCDS DB by Protein ID:ENSP00000493092
Original member Current member EBI ENST00000641287.1 ENSP00000493100.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641287.1Link to Ensembl Protein Viewer:ENSP00000493100.1Re-query CCDS DB by Nucleotide ID:ENST00000641287Re-query CCDS DB by Protein ID:ENSP00000493100
Original member Current member EBI ENST00000641657.1 ENSP00000493105.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641657.1Link to Ensembl Protein Viewer:ENSP00000493105.1Re-query CCDS DB by Nucleotide ID:ENST00000641657Re-query CCDS DB by Protein ID:ENSP00000493105
Original member Current member EBI ENST00000641110.1 ENSP00000493163.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641110.1Link to Ensembl Protein Viewer:ENSP00000493163.1Re-query CCDS DB by Nucleotide ID:ENST00000641110Re-query CCDS DB by Protein ID:ENSP00000493163
Original member Current member EBI ENST00000642009.1 ENSP00000493168.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000642009.1Link to Ensembl Protein Viewer:ENSP00000493168.1Re-query CCDS DB by Nucleotide ID:ENST00000642009Re-query CCDS DB by Protein ID:ENSP00000493168
Original member Current member EBI ENST00000641737.1 ENSP00000493177.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641737.1Link to Ensembl Protein Viewer:ENSP00000493177.1Re-query CCDS DB by Nucleotide ID:ENST00000641737Re-query CCDS DB by Protein ID:ENSP00000493177
Original member Current member EBI ENST00000641911.1 ENSP00000493374.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641911.1Link to Ensembl Protein Viewer:ENSP00000493374.1Re-query CCDS DB by Nucleotide ID:ENST00000641911Re-query CCDS DB by Protein ID:ENSP00000493374
Original member Current member EBI ENST00000641283.1 ENSP00000493444.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641283.1Link to Ensembl Protein Viewer:ENSP00000493444.1Re-query CCDS DB by Nucleotide ID:ENST00000641283Re-query CCDS DB by Protein ID:ENSP00000493444
Original member NCBI NM_001351624.1 NP_001338553.1 Updated not alive Link to Nucleotide Sequence:NM_001351624.1Link to Protein Sequence:NP_001338553.1Re-query CCDS DB by Nucleotide ID:NM_001351624Re-query CCDS DB by Protein ID:NP_001338553
Current member NCBI NM_001351624.2 NP_001338553.1 Accepted alive Link to Nucleotide Sequence:NM_001351624.2Link to Protein Sequence:NP_001338553.1Re-query CCDS DB by Nucleotide ID:NM_001351624Re-query CCDS DB by Protein ID:NP_001338553Link to BLAST:NP_001338553.1
Original member NCBI NM_138980.3 NP_620446.1 Updated not alive Link to Nucleotide Sequence:NM_138980.3Link to Protein Sequence:NP_620446.1Re-query CCDS DB by Nucleotide ID:NM_138980Re-query CCDS DB by Protein ID:NP_620446
Current member NCBI NM_138980.4 NP_620446.1 Accepted alive Link to Nucleotide Sequence:NM_138980.4Link to Protein Sequence:NP_620446.1Re-query CCDS DB by Nucleotide ID:NM_138980Re-query CCDS DB by Protein ID:NP_620446Link to BLAST:NP_620446.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001338553.1 426 P53779-3 426 100% 0 0
NP_620446.1 426 P53779-3 426 100% 0 0

Chromosomal Locations for CCDS 3612.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 86017228 86017370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86029197 86029274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86031368 86031431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86064266 86064390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86067773 86067955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86098524 86098595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86101052 86101217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86101894 86102032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86103186 86103244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86107223 86107352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86159298 86159419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1281 nt):
ATGAGCAAAAGCAAAGTTGACAACCAGTTCTACAGTGTGGAAGTGGGAGACTCAACCTTCACAGTTCTCA
AG
CGCTACCAGAATCTAAAGCCTATTGGCTCTGGGGCTCAGGGCATAGTTTGTGCCGCGTATGATGCTGT
C
CTTGACAGAAATGTGGCCATTAAGAAGCTCAGCAGACCCTTTCAGAACCAAACACATGCCAAGAGAGCG
TAC
CGGGAGCTGGTCCTCATGAAGTGTGTGAACCATAAAAACATTATTAGTTTATTAAATGTCTTCACAC
CC
CAGAAAACGCTGGAGGAGTTCCAAGATGTTTACTTAGTAATGGAACTGATGGATGCCAACTTATGTCA
A
GTGATTCAGATGGAATTAGACCATGAGCGAATGTCTTACCTGCTGTACCAAATGTTGTGTGGCATTAAG
CAC
CTCCATTCTGCTGGAATTATTCACAGGGATTTAAAACCAAGTAACATTGTAGTCAAGTCTGATTGCA
CA
TTGAAAATCCTGGACTTTGGACTGGCCAGGACAGCAGGCACAAGCTTCATGATGACTCCATATGTGGT
G
ACACGTTATTACAGAGCCCCTGAGGTCATCCTGGGGATGGGCTACAAGGAGAACGTGGATATATGGTCT
GTG
GGATGCATTATGGGAGAAATGGTTCGCCACAAAATCCTCTTTCCAGGAAGGGACTATATTGACCAGT
GG
AATAAGGTAATTGAACAACTAGGAACACCATGTCCAGAATTCATGAAGAAATTGCAACCCACAGTAAG
A
AACTATGTGGAGAATCGGCCCAAGTATGCGGGACTCACCTTCCCCAAACTCTTCCCAGATTCCCTCTTC
CCA
GCGGACTCCGAGCACAATAAACTCAAAGCCAGCCAAGCCAGGGACTTGTTGTCAAAGATGCTAGTGA
TT
GACCCAGCAAAAAGAATATCAGTGGACGACGCCTTACAGCATCCCTACATCAACGTCTGGTATGACCC
A
GCCGAAGTGGAGGCGCCTCCACCTCAGATATATGACAAGCAGTTGGATGAAAGAGAACACACAATTGAA
GAA
TGGAAAGAACTTATCTACAAGGAAGTAATGAATTCAGAAGAAAAGACTAAAAATGGTGTAGTAAAAG
GA
CAGCCTTCTCCTTCAGGTGCAGCAGTGAACAGCAGTGAGAGTCTCCCTCCATCCTCGTCTGTCAATGA
C
ATCTCCTCCATGTCCACCGACCAGACCCTGGCATCTGACACTGACAGCAGCCTGGAAGCCTCGGCAGGA
CCC
CTGGGTTGTTGCAGGTGA


Translation (426 aa):
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRA
Y
RELVLMKCVNHKN
IISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK
H
LHSAGIIHR
DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWS
V
GCIMGEMVRHKILFPGRD
YIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLF
P
ADSEHNKLK
ASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIE
E
WK
ELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAG
P
LGCCR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser