NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS36110.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36110.1 Public Mus musculus 11 Abca13 23 108 98 CCDS HistoryNCBI Gene:268379Re-query CCDS DB by CCDS ID:36110.1Re-query CCDS DB by GeneID:268379See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36110.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000042740.12 ENSMUSP00000040465.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042740.12Link to Ensembl Protein Viewer:ENSMUSP00000040465.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000042740Re-query CCDS DB by Protein ID:ENSMUSP00000040465
Original member Current member NCBI NM_178259.3 NP_839990.2 Accepted alive Link to Nucleotide Sequence:NM_178259.3Link to Protein Sequence:NP_839990.2Re-query CCDS DB by Nucleotide ID:NM_178259Re-query CCDS DB by Protein ID:NP_839990Link to BLAST:NP_839990.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_839990.2 5034 Q5SSE9-1 5034 100% 0 0

Chromosomal Locations for CCDS 36110.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 9191966 9192034 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9216158 9216251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9220772 9220895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9249590 9249741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9251359 9251387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9256170 9256333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9258461 9258591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9262004 9262137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9267457 9267621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9269130 9269329 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9273885 9274012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9274679 9274779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9275014 9275187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9276911 9277116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9277830 9277972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9288418 9288532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9290268 9294965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9297082 9298884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9301260 9301369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9309016 9309134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9314479 9314642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9315350 9315429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9316126 9316247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9328047 9328241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9331540 9331704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9333165 9333342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9335131 9335270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9345940 9346053 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9354826 9354916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9373273 9373449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9378214 9378520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9397741 9397855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9399135 9399464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9402146 9402215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9403787 9403918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9430546 9430683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9431727 9431907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9434108 9434326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9451339 9451535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9464909 9465066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9466372 9466602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9483810 9483915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9510461 9510731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9522336 9522419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9528978 9529047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9532365 9532483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9534445 9534532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9542062 9542173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9566276 9566330 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9567668 9567845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9570545 9570660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9577151 9577307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9581494 9581747 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9585351 9585546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9588388 9588497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9615657 9615807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9621871 9622005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9628565 9628668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9636544 9636636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9679824 9679929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9681950 9682087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 9683279 9683377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (15105 nt):
ATGGGGCACGCTGGGCGCCAGTTCCAAGCCCTGCTCTGGAAGAACTGGATTTGCAGACTCCGGCATCCAG
TC
CTCTCCCTGGCTGAGTTCTTCTGGCCGTGTATCCTGTTCATGATTCTGACAGTACTTCGTTTTCAAGA
A
CCTCCCAGACACAGAGAGAATTGTTACTTGCAAGCCCGGGATCTGCCCAGCCGGGGTGTTCTTCCTTTT
GTT
CAAGGACTTCTTTGTAATACTGGCTCAAGTTGTAGAAACATCAGCTTTGAGAGTTCCATGGATCATC
AT
TTTCGTTTGTCTAGGTTCCAAACTGCATCTGATGACAGAAAAGTCAGTAGCTTGGCCTTTTTAAACGA
G
ATTCAGGATCTGGCTGAGGACATTTTTGAAACCATGGACAAGGCAAAGAACTTACAAAAACTCTGGCTA
AAA
AGATCAGAAACCCCAGGTTCCTCTTATGGCTCCGGTTTTCTAACAATGGATCTCAATAAGACTGAGG
AT
GTGATATCAAAATTGGAAAGCCTTCACCAGCAGCCTCATATTTGGGATTTTCTACATTCACTGCCCAG
A
CTGTACATGTCCAGTGCTCACTTGGAAGATAGCATGGGTGCTGTGACACACTTTCTCCAGGCGGGTTTG
AA
T
TCATTAGCATCTCTGGGAGATTTGGATTGGCTACCCCTGCACCAGACCATCCCCCAGGTTTCTAGAC
AT
GTTCTGAACGTGACCATCTCCACCCTGAGGTTTCTGCAGCAGCACAGCGCTGTTGTCAATGAGACCAT
T
TACCACCTGTCCCTGAAGAATATCGTCTGGGATCCCCAGAAAGTCCAGTCTGATCTCAAATCCCAATTT
GGT
TTCAATGACTTTCAAATGCAACACATCCTGAATTATTCAGCGAAGCTGGAGGAGATTCCTACACACA
GC
TTCCTAGAGAGGATGGTATGTTCCATCTTGTCCAACACTTCTGAGGATGAAGCCGAGAGCAAGGGCTA
C
CGGGCAGACTGTCATCCCAAGTGGTCAGCAGTCAAGAACTACATCATCCATGCAGTCAGTTGGCTGAAG
CTA
TACGGACAGGTGTTTGACCAGTGGCAGCAGGGTAGTCTGCTGCAGAGCCTGCTTGCAGGTGCCAGTC
AC
AGTCTGGCAGCCCTTAGGGAGCAGTTTAAACAGCAGAGCGAGTCGTGGAAGGTGGTGGAAGCCCTGCA
C
ACTGCCCTGCTCATCTTGAATGACAGCTTGGCAGCGGATGTCCCCAGAGACTACCATCTGTTTCCACAG
AT
A
TTCCAGCATCTAAGCAAGTTGCAGCATGCCCTGTCAGACCTGTCCCCATGGCCAGCTCTGAAGAGAT
TG
CTCCTGCTGGATACTGTTCTCCGGAACATGATTGCCCAGGATTTGCGATTTGTTCAAGAATTCCTCAG
C
TACCTGGAGAGGTCAGCAAAAGATTTTATACCTGCTGGGTCTGAAGGATGGAGACTAGAAAAGGATGTG
TTA
TTTCAGGGGCTAAACCAGCTGTTGACAAAGAATGCTTCTGCCCTTTGCCTGAATGGACATTTGTCTC
AG
GAGGCTGCCCTCCCCACTGGGAACTCTAGCATATGGAGGAGTGTCTGGGGAGTGCTATGCCATACCCT
A
TTCTTCAACGAGACCAGTGTTTTAAATGAGCTGCTTCGAGCAGTGAAGGATGCTGGTCATAGTTTGCAA
GCT
GTCATTGCAGGACACACAAATGGATCAGTTTCAGAACATGGTGGGCATTTTGGCTGGCAGGATCTTG
GG
ACACAGCTGTCAGAAATAAGCCTTACCTGTTCTCGGGTCTTCCAGCTTCCAAGAGCTGATACCTCACC
T
GAGAATAGTTTCTCTCCTGGTGGCTGTGAAAGCCAGCTTGTCTCCATAGTGGTATCTCACATACTTGAA
GAT
GTACAAATGTCTACGCAAAAGAAGTCCTACTGGAAAATCCTCTCAAAAATCGTCAGGAAGACATGTG
AA
TTGGCTCGATATGTGAACATGAATGGCAGTCTTCAGAACAGTGGGCTGATATCTTTCTCTGAGGACTC
T
CCTTGTTATACACAAGACATGAATTGGAAAGTCATCATTGATAATTATTTTGTATTTTTCAATAACTTT
AAG
AAGTCTCCAATAACTTCCATAACCACGGCCTTCAATTTCACAAAGCACCTTTTAGTGGTGGATCAGA
AG
TTGCACACCCTTGAAAATGGACAGATGAACATTCTTCTGTCGTTTGTGGAGTTTGTGGAGAAATTACT
A
TCTAATCCCTCTGGCTCATTCCCTGCTCCTGAATTTGATAATCTGTCTTCTCTCACTGAGCTTGTTTTC
AAT
GCAACTGTTTCATGGCTAACTCATTTAAAGCGTTTAAAGGCAGACTCCCATGATGCTGCTCCTCAGG
AG
CTTCTGGAATTTGATCATCTGGTCACTGAAAAAATTCAAAGACTTAAAAATCATTGGATGAAGAAGGG
A
TCTAAAAATATTTTGAACTTTTTAGAATTAATACTTCTTGAAATGAATTCAGAACTGCAAGAATTCCGG
CTC
AATGGCATTCCACAAGAAGAAAGAACTAACATTGAAGGCTTTTCCACACTTGTAAATTTTTCTGTTG
CA
GAATATGAAAAAATTCTTTGTAAACGCTTTACTTTCTCCCAATTGTTCCATTCCTATTGGCCCAAATC
A
CCAGCCATTAATGCAGACTTTATACATTTAAGTGAGACTATAATACAGAGTCTCTGTGGACTTAGCTTT
CTG
ACACAGGAGCAAGTCTCAATAGCTCTGAACACTGTCTCTGCTCTGCAGAATACATCTGAGCTTTTCT
CT
GCCCTTTCTGAGCCACAAAAACAAGAACTGGATAACTTTTTGACTCATGTATACATAAATGTCTTCAA
G
GACAAAAACATAGCTCTATTTTTGCAAACCTATTCCTCATTCTATCGATATATTCATAAATTCTTCAAC
ATT
CAGAATAGAGAGCCTCTGATAGCTTATTTTACTCAAATCTCCAGACACATTTTGGACCTCATAAAGC
AG
TTTAATATCCAAAACATCAGAGAAGCACTTTCGTTTTTATCGGAGACAACAGAGGCTCTTGGGATGAT
A
TCTGAAGTATCTCACTGTCAGCAGTTACTTTCAATTTTCAACTTTTTAGAACTTCAAGCCTGGTCCCTG
ATG
GCAAGAGGGGGACCAGCAGAAGCAGTGATTCATGCTAGTTTGACAGGCCTCAAGCAGCTGTTCGCAG
CA
GATGAAGGCTTTCGTGTTTCTTTACTTCAGTATGTGACTCAGTGTTTTAATGGTTCAGCAGCAACTCT
A
GTGGCGAGTGAATGCTTCATTCAGGAAAATGCTACCATTTCTTCTGTGAATTATTCAGGAAACGAGGGG
TCT
TCCCTTCCTTTTCCATGGACACAATTTTTTTCCAACCTCTCAGTAAATGGTAGTGCAATCAGCGAAT
TC
ACGGCCATTCACTGCACCCTTTCATGGATTCAGACGTGGGCTGAGATCTGGAGAAGCATTGCTCAAAT
A
TTTAAGCTTGAGCTGAGTATTTTTACTCCTCTTCATGTTGGTATCACTCAGCTGTTGGATGACCTGGGA
AAT
TATGGGAACATTTCTAAAGACTGCCAAGGAATAGTTCCCACATACCTTACTGCTAGGCTCATATTAA
AT
TTGTTTAGAAATATAACTCAGGAGAATAACTTCCATGACTGGGATGGCCTTCAGGACCTCAGGGATCT
T
TGGGTAGCATTTGGTAATGAATTAACTACAGTACAATCACTTAACCTGGACCAAGTAGAGAAAACTTTT
ATC
ACCATGGAAACCTCCCTGCACCAGCTGAAGACATTTCCAATGAAAATAAATGCAAGCAGGGAGTTTT
TA
TATTCCCTGTTTGATGTTTTCATTGAGTTAAGTAAAGCCTCAGACTATGTGGATAGAAATGTGGAGTT
G
ATCAATAACTTTCTTTCAGATGATCTTCCTGATCATCAAGCCAAATTTGCAAGCATCATCAAGGAGCTG
AAA
GAAACAATATTATTTCTTAGGCATGTGTCACAGGGTAGAACTTTATCAGCATGTGCTGATATTTTCC
AG
AGACTCACTGAGTTGATTTTTGAAGATAGCTTATTACTTGTGAACACTTCTAATAAGCCAGAACATAT
T
CTGGCCATGTTAAGTTCTATGTTTTCATCAAAGAACACAAGTAGCAGCCTGGAAGGGTGCATCACATGG
ATA
GATATCATAAACCATCTGTGTATAATGTATAACTCAAGTTCCTTACCCAGTCATAGTTATAACATAC
TG
GGAAGCTTTAAGGATATGGGGGACAAAATGAGCTCTGCATTGAACATTTTAACTTGGATGCTAAATAA
G
AAAAGACCCATTTGTCCATGGAATGAGTCAAATATAAATTGTGTAAATATTTACTTGAAAGACATAACT
GAC
TTTCTAAATATTATAGTTACTACAGGCTTGGAAAAAGAGAATGTGCCCAATGTTGAGATTTTATTAT
CT
CTTTTCAATGATTCCACAAAGCAGGTAGACATGATCATTACCAACTTAACAGAAGATCTCAATGTTGC
T
TCCCAGTCCAACTGGAAGCACTTCAAGGATTTACTTCTAAGACCCACAGAAATGTCAGATGATATTCCT
GAC
CAGTTTCAGAATATTTGGCAGCACATCATAGCATTGGGGAAGGAAATGCAGAAGCTTTTAAAAGGTA
TT
TTCCATAGTGTCCTCGGAAATAATTTCTCTTCTAACACTGAAACAATGTTTAGTGTATTCTCTACCAG
T
CCAAAGGAAGGAGATATAAGCCATTTAGGCAAATCAATTTACAACTTAGCTAACTACTTTGCTCTTAAC
CTA
ACTCATAATCTTCAGAATTCATCAGAAGTATTCCCACATGAAATATTGAAAGCTGTAGATCTTAGTA
TA
CAATTGACACGGGATGTGTTCAATTTTTTAATGCCTGCTGTCCACTTCAATATTCCACAAAATTCAGA
T
CATGCTCAAACTTTAAAGAAAGTGACATCTCTCATGCAATCTCTCAAGAAGGCAGACATAGAGCTTTTA
GTA
GGTCAGCTGGGAGAAAACAGTGAAATCCTAATGAGTTTCTTTAAGAATCTCAGCAGATCAGGTATTG
AC
AACTTGGGGGTCAATATGCTTGTGGGCTTAGTGGAAAAATTTGTAGACAGTTCACATTCATGGAGTGT
T
AGCCACCTGTTGCGTCTCTCCCGTCTGCTTCCCAAGGATGTGGTGGATACTGTGTTGGATGTATATTAT
GCT
CTTCCCCACATTGTGGGACTCCTTCGGAGAATCGTAGATAAAAACATCACAGAAAGCCTCAGGGATG
TC
TATAACTTTACCCTTCTTCATGGCATAACCATGTTCAAAATCACCAAGGAAGACTTTGCTGATGTCGT
T
AAGACTCTTCTGGATGCAGTTGAGTTGGTATCAGATGAGCCAGCTATTGTTCCAGAAGCTTTGATGTGC
CTT
ACCAGGGTTTGGTGCGCAAACTACACAACTTTCAGGCTTGAGAAAAACCCTAAGGTCGAAGACTGTA
AT
ATCCAGAGGCACATGCCTTCATCCTTCTTTCACATGGTGACCAGTCTACTGGATCTTCTTCACCTGCC
A
CCCCCAAGCGACTCACAGTGCATAGGTGAAAAGTATGCAGTGGAAATAACCAGGAGATTGGCCTGTGCA
GTC
CATGACCTAGCAGACTGGAATTCCATTCTCTCGGAGCTATTGGAGATTTTCCATGTTAAAAATTTAC
TT
GTGAAAACTCTGCAGGGATTTTGGCATAAGGTACTGCTCTTCATGTCATCTTCTGGAATTCAAGGTAA
T
GGCAGCATCCCAGAACTCTGTCCTACTAGTACCATAAAGCAAGGTGCTTTGCAAATCATAGAAAAGCTA
AAA
TATGTCAATTTTACAAAATTCTCACTGGGTGAAACCATTCTGGACAGGCTAGGTAACTTAGACAGGA
TT
CTTAGCCTCACTAAAGGTACAGAGAAATCTGTCCAAAATAATATTTACTTAAATTTGGAAAGGTTATT
C
AAATTGATTTCTGCTACTTGGACTTTAAGAAATAGTACTCATTATCTACTCTCTCCAATCACAAACTTT
CTG
AATGGAAATTATACAGGTTGGAGTTTGTTTAAAAACAATAGAACAAGTTCCAACATTGAAGAACTGT
GG
TTGGACTTTAAACAGATTCCCAAAGATCTAACTAGTAACTGGAGCCTAGGACAGTTACTTTCCGATAT
T
AACAAAAATATCCAAGGTGCAGGTCTTCAAAACACCACTGTGCAACTTCCTCAACTTCTGGAACTCCTG
GAT
TCATCACCATTGAAGACATCAGAAATTATTGAAGGTTTTCTATTTCTCATAAAACCCTGGCTTCGTG
AG
TATGAAAATGGAGACTTCTTTAGGTTTATTCAAAGTCTACTCAATGCCGTGGCCAGTGGGAATTCAAC
T
GATGTAAGTAGGTTGGCCAGGGATTTTACTATGTATTTGGGTTATCTCAGAAACCAATCTAGAGAAGGC
AAT
TTTGATGTTGGCTTTTTCAGCCATATGCTAGATCAAGAGCACCTCACTGATCTCCCAGTTGTTCAGC
GG
CTTCTTGAAAGCATTGTGATGAATTCAGTTAGTAGCTTTGCAGCGCTATCTCAGGAAACGCCTCCCAG
T
TTCAGCGGCACCAACCTTCAAATAGCAGATCTCATGAATCTCATCTTGAAGCACGCGCAGTCCAAAAAC
CAT
GCGGAAGCTGAAGGAAGCACAGAGGATTTCCTGAAGCAGCTTCCAGAGACATTCTTCTCCTCCGTGA
TA
AATGGATTGCATAGCGATGTCACTGCAGAGGTGAGTTTTGTCCCTAGAGATAAAATCCTTGAAATTCT
G
AAACTGGATCCGTTCCTTACCTGGATGAACAAAAACCCATTGATGAACATTTTCTCAGGTCTCAAGACA
CTA
TATTATCTGATTAAGAGCTCATTTTCATTAGACAACAGAGAACTCTCTGGAGTCCTGAAGGATTTAT
CT
CACACCCATCCATGGGAGACCACAGTGAAAACTGATGCCGAAGGCCATTTGGATTTCTTTTCAGTAGT
G
ACTCAGTTTCTCTCCCAGGTTAATAGTTCTGAGGACCTCTCCAAATTCAACCAAAATCTCAGGTCTGTT
CTC
TACCTTGTACAGGAAAGTTCTACAGAAATGGCTACTATTATTGACACTGTCTTACATTCAACTTCTG
GG
GCCTGCTACTCCCCCTATCCTATGCTTCAGCATAGCACAGTTGCTAAGCTAAGTGACTTGTTTTCTGA
T
GTCAACAGTTCATTCCCTCTAAGAAGCAGAGAAATACTAGAATCAACTATGAGGCTATTTGGCACTATT
TCC
CAGGTTGGTGAAGAAAGTCATGTCCTGGAGTCAGCCTTAGAAATATTTAGAACTCTGACTATGCTGG
TG
AATAGCACTGTTGAACTAGGCCATCTTGCCTCAACTGCGGACTCCATGGTTAGACTTCTCAACCTAGC
C
AAAATTGTTTCAAGAAAGATGGCTACAATGTTGGGAACGCTCTCCATCTCTAGTACTGAGGACTCTGGG
AAA
TTCCTTGACACTTTGTATTCCTTCATGCTACAAAGTGTTCCACATCATGTGAAGCAAATAACTACTT
TG
AAAAAAGGAGATCCTTTTATAGTTGAAAAGACAAAGGATTTATTGATACCATTTCTTGACTTGGCCTT
T
GGAATGATTGGAGTCACACCTAATGTATCACAGGACTCTGATGTTTTCAGCATGCCATTTAGCATACTT
TCA
TATATCAACCAATCCAGAGACTTTTCTGAGACTTTGGAAGGAATGGCTGAAAACTTAATTTCTATAA
AA
ATCAGCTTGAGAGATTGGGAGCATTTTGTGGCAATGATTAAAAATAGGACTCAAAATTTCTCTATTGA
T
GCTGCTGACTTATGGGAAGAAATTTTAGGTTGTTTAGTCCCTATAAGTAACATCACAACCCAGATGGAC
TTC
TTGAAGCTTTATGAGCTCTCTTCTACCAGCCATCCTCAGGTCCCGAAACAGGAGAGAACTCATGATG
TA
ATCCGGTATTTGGATGGAATGTTAACAGATAACGGCACAGAAAGAGAGACTTTCTTGAAAATGGTGAT
T
GACCTCACCTTACAAGCTCTTTGGAATGGCTTAAAGGAAGATAACTGGGATATTTTTAATCTCCTGTTG
GCA
TTTGCCCAGCATCCAAATGATCTTTTAAAAGCCATAGAATCAGTTGTAGCGGTCTCTAGTGGAATCC
AC
AGTGACTATCCAGATGATTTCAACCAAGATTCATTTTCTGATTTGTCACTGATTCAGAACACTACTCG
T
TATCAGCTTGCAAAGGCTGTCCTGATTGGTCTCGGCAAAGCAGGCTTCTCAAGGGAAGGGCTGCCCCTG
AAC
AACACTCAGTGGACACATTTCACACGCACTCTGTTTCACCCAGATTACAACAGTTTTCCTAATTCAA
CC
CCTCATCAGAATGTCACATCAGCAAAGGATGGGAGGACCAAGGATGAAATGATGGTAATTCTTCATGG
C
TCAGAGCCAATGCCATACCTCCAGAGATTCCTGAAGGCATTATTTGTATCGATTGAGCACTGGCAGGAA
GTC
CCACAAGCTGAGCAAAGTGTTTTTGAGATGTGTCAAGTTTTCCAGCAGCTGCAGAAGCCCATGAAAA
CT
GTGAAGATGCTGCAGAGAGTGGAAATGATGGCTCTGCGGGTGCTCATTATCTTTGCAGAAAATCCTTC
C
CTGACTAAGGACATTCTGTGTGCTGCGCTGAGTTGCAAGCAAGGTGCGATGAGGCACCTTATCTTAGCT
GCT
TTGCAAGGAGTCACTTTGGTCCATCGCCACTACCAGGAGATTGGAAAGATATGGTTCTCACCTGATC
AG
TTGGACTGTGAACGTCTTAGCAGGAATCTTTCCAGTGCCTTGGAAGGCTTTAAAAGCATCTTGGACAA
T
GCTTCCAGCCATCGCTGCACGTGCCAGCCCTTGGTGGGAGTGGTTCAGCAGCACATACGCAGGCTGACC
AAA
AGTCTTGAGGAGGTTTGGATGTCAAAGATTCCTGCTATGACATTTCTTAGCAATTTCACAGTCACAG
AG
GATGTAAAAATAAAGGATTTGATGAGGAACATCACCAAATTCACTGAGGACCTTCGCTCCTTCTTCCA
C
ATCTCTGAGGAAACCATCCACAGCATCTTAGAAGCCAACATTTCCCATTCAAAGGTTCTCTCCAGTGTC
CTT
ACCATCGCTTTGTCTGGAAAATGTGATGAAGAAATTCTCCATCTCCTGCTGACGTTTCCTGAGAGTG
AA
AAATCCTGGTTTGTCACAAGGGAACTCTGCAGCCTGCCTGGGTCTCAAGTCTTCTCTCTACTTGTGAT
G
ATGGGCCAGAACCTGAACCTGAGGAACCTCATTTACAAAACTCTGATACCCTCTGAAGCAAATGGCTTG
CTG
AAGTCTCTGTTGGATGTCGTTGCTAGCCTCAGCTCCATTCTTGCCAGAGCCCAGCATGCCCTTGAAT
AC
CTCCCTGAGTTTCTTCACACATTTAAAATCACTGCCTTGCTGGACATGCCAGACTTCCAACAGGTTTC
A
TCAAAGGGACAAACCAGAAGTTCAGCTTTCGCCTCTTTCCAGTCTGTAATGAAGCTTCTCTGTAAGGAC
CAG
GAGTCTTTCCTCAGCAATTCTAACATGTTCATTAATTTACCCAGAGTTAATGAACTCTTGGAAGATA
AC
AAAGAGAAGTTCAACATTCCGCATGACTCAACACCATTCTGTTTGAAGCTTTATCAGGAAATTCTACA
G
TCTCCAAATGGTGCACTAGTATGGTCTTTTCTAAAACCTGTATTACATGGAAAAATATTGTATACACCA
AAC
TCTCCAGAGATTAATGAGGTCATTCAAAAGGCTAATTATACATTTTACTTTGTGGATAAGATAAAAG
TT
TTATCGGAAACATTTCTGAAGATATCCAAACTTTTCCAGGGAAGTGGAAATGGTCAAATGTTCAACCA
G
TTGCAGGATGCCCTGAGAAACAAATTTATAAGAAACTTTGTAGAGAGCCAGTTGCATATTGACATGGAC
AAG
CTCACTGAAGATCTGCAGACATATGGACGGATGTTAGATAAGATGTTTAACCACGTGGAAGCTGGAC
AC
TTCCGGTTCTTGGGTGGTATGTTGGCCAATCTCTCTTCCTGTGTGGTGTTGGACCGATTCCAGGCAGT
G
GAGACTGTTGACACCCTGGAGACCAAGGCACATGAACTCATGCAGCAGAATAGTTTCTTGGCCAGTATT
ATA
TTCAACAGTTCCTTGAGACATAGACACATTAGATCAGCACCTCACAAATTGCCACCCCACGTCACAT
AT
ACAATCCGGACCAATGTCTTATACAGCATGAGGACAGACATGATAAAAAATCCTTCCTGGAAGTTTCA
T
CCTCAGAATCTACCAGCCGGCGGATTCAAATATAACTACATTTTTGTCCCACTTCAAGACATGATTGAG
AGA
GCCATCATTGTGGTACAGACTGGGCAGGAATCCCTGGAGCCAACCACACAGGCACAGGCAGCACCCT
AC
CCATGCCATACCAGTGACTTGTTCCTAAACAATGTCGGCTTCTTTTTCCCACTGATTATGATGTTGAC
T
TGGATGGTAGCTGTGGCCAGCATGGTCCGGAAGCTGGTGTATGAGCGAGAGATCCAGATAGAAGAGTAC
ATG
CGGATGATGGGACTGCATCCAACCATCCACTTCCTGTCCTGGTTCCTGGAGAACATGGCCACTCTGG
CT
CTGAGCAGTGCTGCTCTTGCTGTCATTCTGAAGATGAGTGGCATCTTCATGCACAGTGATGCCTTCAT
C
ATTTTTCTTTACTTGCTGGATTTTGGGGTGTCAGCTGTCATGATGAGCTACTTCCTAAGTGTGTTTTTC
AAC
CAAGCTAATACAGCAGCCCTGTGTACCAGCCTGGGGTACATGATCAGTTTCCTGCCCTATGTGGTCC
TG
TTGGTCCTACATAACCAACTCAGTTTCGCTATTCAGACTCTTCTGTGCTTGCTTTCAACCACAGCCTT
T
GGACAAGGAGTCTTTTTCATCACATTTCTGGAAGGACAGGAGGAAGGGATCCAGTGGGGTAACATGTAC
CGC
GCTCCAGAGCCAGGGGGCATGACATTTGGCTGGGTGTGCTGGATGATTCTGTTTGATGCAATCCTTT
AT
TTTTTGGGTGGATGGTACTTCAGCAACTTGGTCCCTGGAACTTTTGGTTTAGGGAAACCATGGTATTT
C
CCCTTCACTGCATCATATTGGAAGAGCATATGTGGTCTGATGGAGAGAAGGCGATGTTCTCTGAGTTCT
GGT
CTGTTCTTCTTCAATGAGGACTTTGGCAACAAAGGGCTCTCACAGCAAAATGGCCCAGGAGAAATGG
AA
GGAGGTAACCCAGGAGTGGCTCTGATATCTGTGACCAAGGAGTATGAAGATCACAAGGTGGCTGTCCA
G
GAACTCACTCTCACCTTCCACAGAGACCAGATCACAGCCCTGCTGGGGACCAACGGTGCAGGGAAAACC
ACC
ATCATATCCATGTTGATGGGGCTCTTTCCTCCTACTTCTGGAACCATCACCATAAATGGCAAGAATC
TG
CAGACAGATTTGTCCAAGGTCAGAGAGGAGCTGGGGGTGTGTCCACAGCAGGATGTTCTCCTGGACAA
C
CTCACTGTGCGTGAACACCTAATGCTCTTTGCCTCCATAAAAGCACCTTGGTGGACCACGAAGGAGCTA
CAG
CAGCAAGTCAACAAAACTCTTGATGAAGTAGAGCTAACTCAGCATCAGCACAAGCCAGCTGGAGTTC
TC
TCTGGAGGCATGAAGAGGAAGCTCTCCATTGGCATTGCTTTCATGGGCATGTCAAAGACAGTGGTTCT
G
GATGAGCCAAGCAGTGGGGTGGACCCTTGTTCCCGTCGCAGTCTCTGGGACATTCTACTCAAGTACCGA
GAA
GGTCGCACAATTATCTTCACAACCCACCACCTGGATGAAGCTGAGATGCTCAGTGACCACGTGGCTG
TT
CTCCAGCAGGGGAGGCTCAGATGCTATGCTCCTCCTGCAGACCTGAAGGAGACCTATGGTCAAGGACT
C
ACCCTGACGCTCAGCAAGCAACCCTCTATCCTAGAAACACAGGAGCCCAAGGATGTGGCTCGTGTTACA
TCC
TTGATACAGATCTATATTCCACAAGCATTCCTCAAAGATAGCTGTGGAGGTGAGCTGACCTATACCA
TC
CCCAAGGATGCAGACAGAACCTGCTTCAAGGGGCTCTGCCAGGCTCTGGATCAGAACTTACAGCACCT
G
CACCTAACAGGATATGGGATCTCAGACACCACCTTGGAAGAGGTGTTTTTGATGCTTCTGCAAGATACC
AAC
AAAAAGTCTTACATCACTCCAGACAACAAAGTAGAGCCTCAGAATGAGAGACCTGTAGGACCCCTTT
CT
CCCCACAATGTCTCTCCCCTGAGCACTCCACCAGAAGGGGCCCTGCCTGAGCCGATAGGTGGCTGCCA
G
CTACTTCTGGGACAAGCAGTGGCACTCCTGAGGAAGCGGCTACTGCATACACTTCGAGCCTGGAAAAGC
ACC
ACCTCAGATTTGTTACTGCCTGTGCTCTTTGTGGCCTTGGCCATGGGCTTGTTCATGGTGCAGCCTT
TG
GCCATCACGTACCCTCCACTCAAACTTACACCTGGCCATTACGAGACTGCAGAAACTTACTTCTTCAG
C
AGTGGGAACCATGGCCCAGACCTAACTCATGTGCTTCTGCGCAAGTTCCGAGATCAAGACCCTGTCTGT
GCT
GATGCTTTCAGGATGAATTCTTCAAGCTGGCATAGGGACCCTTATTCTGGCCCAGAATCCCAGGACT
CA
TGTGGCTGCCTGAAGTGTCCAAATAAAAGCGCTGGTGCTCCCTCTCTGACCAACTGCCTGGGACACAC
A
CTGCTCAACCTCTCGGGCTATGATGTGGAAGAGTACTTGCTGGTGCCATCTGCAAAACCAAGGCTTGGA
GGT
TGGTCTTTTGGAGGACAAATACCCAATGATGCTGAAGATGTGAAGACAAACACATCAAAACCAAGGA
CT
TTGGCGAAGGTGTGGTACAACCAGAAGGGTTTCCATTCTCTACCCTCCTACCTGAATCATCTCAACAA
C
CTGATCTTGTGGCATCACTTACCTGCCAATGCTGTAGACTGGAGACAATATGGAATAACCCTGTACAGC
CAC
CCATATGGAGGGGCCTTGCTGAATGAAGACAGGATCCTGGAGAGCATCCGCCAGTGTGGTGTTGCCC
TC
TGCATTGTCCTGGGATTCTCCATCTTATCAGCATCGATTGGTAGCTCTGTGGTGAGGGACAGAGTGAC
T
GGAGCTAAAAGACTGCAACATATAAGTGGCCTTGGACACAGGACATACTGGCTAATTAACTTCCTGTAT
GAC
ATGCTCTTTTACTTAGTTTCTGTCTGCCTGTGTGTCGCTGTTATAGGAGCCTTCCAGTTAACAGCTT
TC
ACATTTCGGGAGAACTTGGCGGCCACAGCCCTCCTGCTAGCACTTTTCGGATACGCAATGATTCCATG
G
ATGTATCTGATGTCCAGAATCTTCTCCAGTTCAGATGTGGCCTTCATCTCCTACATCTCCTTGAACTTC
ATC
TTTGGCTTGTGCACCATGTTGATGACCACCATGCCCCGGCTCTTGGCCATCATTTCCAAAGCTCAGA
AT
TTGCAGAAAATCTACAATGTCCTCAAGTGGGCTTTTACTATTTTTCCTCAATTCTGCCTGGGTCAAGG
G
CTTATAGAACTCTGTTATAATCAGATCAAGTATGATCTGACTCACAACTTTGGCATTGATTCTTATGTG
AGT
CCCTTCGAGATGAATTTTTTGGGCTGGATCTTCGTGGAGTTGACCTTGCAGGGCACATTTCTTCTCC
TC
TTGAGGCTGATGTTACATGGAGACCTTCTGAGATGGCCAAGGGACCACTCTGTCCTGCAGGACATAGT
T
AAGCCTGCTAAGGACATAGATGTTGAAACAGAGCAAATGAGGGTGCTTGAAGGAAGAACTGGAGGAGAC
ATG
ATGGTGTTGTGCAACCTCAGTAAAAGTTACAGAAGTGTTTTCGGGGGGAAGACCACGGCGGTGCATG
GC
ATTAGTCTGGGCATACCACGAGGCGAGTGCTTTGGGCTCCTTGGAGTTAATGGTGCTGGGAAGAGCAC
A
ACATTTAAAATTCTGAACGGCGAAACTCCCCCAAGTTCAGGATACACCGTCATCAGGACTCCTCAAGGA
GAT
ATGGTGGATCTGGCTTCTGCTGGCAAAGCAGGCATTCTGATTGGCTACTGTCCACAGCAGGACGCCC
TG
GATGAGCTTCTGACTGGCTGGGAACATCTTCAATACTACTGTAGACTCCGTGGAATTCCAAAGCAGTA
C
ATCCCAGAGGTTGCTGCAGACCTGGTGCGACGCTTGCACCTTGAGTCTCATGTGGACAAACCTGTAGCC
ACT
TACAGTGGGGGCACCAGACGGAAGCTCTCCACAGCCCTGGCCCTGGTGGGAAAGCCTGATATTCTTT
TA
TTGGATGAACCAAGCTCTGGGATGGACCCCTGCTCTAAGCGGTACCTCTGGCAAACAATAACACAAGA
G
GTTCGGGATGGCTGTGCCGCAGTGCTAACCTCTCACAGCATGGAAGAGTGCGAGGCTCTGTGTACTCGG
CTG
GCCATAATGGTGGATGGCAGCTTTAGGTGTCTTGGGCCCCCCCAGCACATCAAGAACAGGTTTGGTG
AT
GGTTACACAGTCAAAGTTTGGCTCCACAAGGAAGGAAGTCAGCCTAGTGCAGTTTCTGACTGCTTGAA
G
CTCCATTTCCCAGGAATCCAGTTTAAGGGACAGCGCCTTAATTTATTGGAATATCATGTACAAAAGAGT
TGG
GAGTGTTTAGCTGATTTGTTCAAAGTTCTTGAGAACAACAAGAGCCTCCTGAATATTGAGCATTACT
CC
ATCAGCCAGACCACTCTGGAACAGGTCTTTGTTAATTTTGCCACTGAGCAGCTGCAAACTCCATGCTT
T
CCTGTTGATTCACCATCTACTGATGCTCAGCATCCATGCTACACACGCATCTAG


Translation (5034 aa):
MGHAGRQFQALLWKNWICRLRHPVLSLAEFFWPCILFMILTVLRFQEPPRHRENCYLQARDLPSRGVLPF
V
QGLLCNTGSSCRNISFESSMDHHF
RLSRFQTASDDRKVSSLAFLNEIQDLAEDIFETMDKAKNLQKLWL
K
RSETP
GSSYGSGFLTMDLNKTEDVISKLESLHQQPHIWDFLHSLPRLYMSSAHLEDSMGAVTHFLQAGL
N
SLASLGDLDWLPLHQTIPQVSRHVLNVTISTLRFLQQHSAVVNETIYHLSLKNIVWDPQKVQSDLKSQF
G
FNDFQMQHILNYSAKLEE
IPTHSFLERMVCSILSNTSEDEAESKGYRADCHPKWSAVKNYIIHAVSWLK
L
YGQ
VFDQWQQGSLLQSLLAGASHSLAALREQFKQQSESWKVVEALHTALLILNDSLAADVPRDYHLFPQ
I
FQHLSKLQHALSDLSPWPALKRLLLLDTVLRNMIAQDLRFVQEFLSYLERSAKDFIPAGSEGWRLEKDV
L
FQGLNQ
LLTKNASALCLNGHLSQEAALPTGNSSIWRSVWGVLCHTLFFNETSVLNELLRAVKDAGHSLQ
A
VIAGHTNGSVSEHGGHFGWQDLGTQLSEISLTCSRVFQLPRADTSPENSFSPGGCESQLVSI
VVSHILE
D
VQMSTQKKSYWKILSKIVRKTCELARYVNMNGSLQNSGLI
SFSEDSPCYTQDMNWKVIIDNYFVFFNNF
K
KSPITSIT
TAFNFTKHLLVVDQKLHTLENGQMNILLSFVEFVEKLLSNPSGSFPAPEFDNLSSLTELVF
N
ATVSWLTHLKRLKADSHDAAPQELLEFDHLVTEKIQRLKNHWMKKGSKNILNFLELILLEMNSELQEFR
L
NGIPQEERTNIEGFSTLVNFSVAEYEKILCKRFTFSQLFHSYWPKSPAINADFIHLSETIIQSLCGLSF
L
TQEQVSIALNTVSALQNTSELFSALSEPQKQELDNFLTHVYINVFKDKNIALFLQTYSSFYRYIHKFFN
I
QNREPLIAYFTQISRHILDLIKQFNIQNIREALSFLSETTEALGMISEVSHCQQLLSIFNFLELQAWSL
M
ARGGPAEAVIHASLTGLKQLFAADEGFRVSLLQYVTQCFNGSAATLVASECFIQENATISSVNYSGNEG
S
SLPFPWTQFFSNLSVNGSAISEFTAIHCTLSWIQTWAEIWRSIAQIFKLELSIFTPLHVGITQLLDDLG
N
YGNISKDCQGIVPTYLTARLILNLFRNITQENNFHDWDGLQDLRDLWVAFGNELTTVQSLNLDQVEKTF
I
TMETSLHQLKTFPMKINASREFLYSLFDVFIELSKASDYVDRNVELINNFLSDDLPDHQAKFASIIKEL
K
ETILFLRHVSQGRTLSACADIFQRLTELIFEDSLLLVNTSNKPEHILAMLSSMFSSKNTSSSLEGCITW
I
DIINHLCIMYNSSSLPSHSYNILGSFKDMGDKMSSALNILTWMLNKKRPICPWNESNINCVNIYLKDIT
D
FLNIIVTTGLEKENVPNVEILLSLFNDSTKQVDMIITNLTEDLNVASQSNWKHFKDLLLRPTEMSDDIP
D
QFQNIWQHIIALGKEMQKLLKGIFHSVLGNNFSSNTETMFSVFSTSPKEGDISHLGKSIYNLANYFALN
L
THNLQNSSEVFPHEILKAVDLSIQLTRDVFNFLMPAVHFNIPQNSDHAQTLKKVTSLMQSLKKADIELL
V
GQLGENSEILMSFFKNLSRSGIDNLGVNMLVGLVEKFVDSSHSWSVSHLLRLSRLLPKDVVDTVLDVYY
A
LPHIVGLLRRIVDKNITESLRDVYNFTLLHGITMFKITKEDFADVVKTLLDAVELVSDEPAIVPEALMC
L
TRVWCANYTTFRLEKNPKVEDCNIQRHMPSSFFHMVTSLLDLLHLPPPSDSQCIGEKYAVEITRRLACA
V
HDLADWNSILSELLEIFHVKNLLVKTLQGFWHKVLLFMSSSGIQGNGSIPELCPTSTIKQGALQIIEKL
K
YVNFTKFSLGETILDRLGNLDRILSLTKGTEKSVQNNIYLNLERLFKLISATWTLRNSTHYLLSPITNF
L
NGNYTGWSLFKNNRTSSNIEELWLDFKQIPKDLTSNWSLGQLLSDINKNIQGAGLQNTTVQLPQLLELL
D
SSPLKTSEIIEGFLFLIKPWLREYENGDFFRFIQSLLNAVASGNSTDVSRLARDFTMYLGYLRNQSREG
N
FDVGFFSHMLDQEHLTDLPVVQRLLESIVMNSVSSFAALSQETPPSFSGTNLQIADLMNLILKHAQSKN
H
AEAEGSTEDFLKQLPETFFSSVINGLHSDVTAEV
SFVPRDKILEILKLDPFLTWMNKNPLMNIFSGLKT
L
YYLIKSSFSLDNRELSGVLKDLSHTHPWETTVKTDAEGHLDFFSVVTQ